Ξ²-glucosidase from Streptomyces sp.

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 479 amino acids
MVPAAQQTATAPDAALTFPEGFLWGSATASYQIEGAAAEDGRTPSIWDTYARTPGRVRNGDTGDVATDHYHRWREDVALMAELGLGAYRFSLAWPRIQPTGRGPALQKGLDFYRRLADELLAKGIQPVATLYHWDLPQELENPGGWPERPTAERFAEYAAIAADALGDRVKTWTTLNEPWCSAFLGYGSGVHAPGRTDPVAALRAAHHLNLGHGLAVQALRDRLPADAQCSVTLNIHHVRPLTDSEADADAVRRIDALANRVFTGPMLQGAYPEDLVKDTAGLTDWSFVRDGDLRLAHQKLDFLGVNYYSPTLVSEADGSGTHNSDGHGRSAHSPWPGADRVAFHQPPGETTAMGWAVDPSGLYELLRRLSSDFPALPLVITENGAAFHDYADPEGNVNDPERIAYVRDHLAAVHRAIKDGSDVRGYFLWSLLDNFEWAHGYSKRFGAVYVDYPTGTRIPKASARWYAEVARTGVLPTA
Magda Faijes et al. (2006) β€” Acceptor-dependent regioselectivity of glycosynthase reactions by Streptomyces E383A Ξ²-glucosidase
Carbohydrate Research  Β· doi:10.1016/j.carres.2006.04.049 β†—  Β· Activity + Stability - Product Formation
9 measurements
Database ID
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli

Experimental Data (9 measurements)

9 measurements
Mutation Property Assay Solvent Solvent Volume Aqueous ReferenceWT Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
E383A Activity + Stability - Product Formation Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC Acetonitrile 5 % v/v 100 β€” 100 % Digital Continuous 50 mM phosphate buffer 7 35Β°C 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside Fluoride ion , pNP-Ξ²-D-Glc-Glc β€” β€” Classical aqueous control (in %)
E383A Activity + Stability - Product Formation Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC Acetonitrile 10 % v/v 100 β€” 98 % Digital Continuous 50 mM phosphate buffer 7 35Β°C 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside Fluoride ion , pNP-Ξ²-D-Glc-Glc β€” β€” Classical aqueous control (in %)
E383A Activity + Stability - Product Formation Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC Acetonitrile 20 % v/v 100 β€” 14 % Digital Continuous 50 mM phosphate buffer 7 35Β°C 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside Fluoride ion , pNP-Ξ²-D-Glc-Glc β€” β€” Classical aqueous control (in %)
E383A Activity + Stability - Product Formation Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC Acetonitrile 30 % v/v 100 β€” 2 % Digital Continuous 50 mM phosphate buffer 7 35Β°C 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside Fluoride ion , pNP-Ξ²-D-Glc-Glc β€” β€” Classical aqueous control (in %)
E383A Activity + Stability - Product Formation Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC Acetonitrile 40 % v/v 100 β€” 2 % Digital Continuous 50 mM phosphate buffer 7 35Β°C 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside Fluoride ion , pNP-Ξ²-D-Glc-Glc β€” β€” Classical aqueous control (in %)
E383A Activity + Stability - Product Formation Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC Dimethyl Sulfoxide (DMSO) 10 % v/v 100 β€” 98 % Digital Continuous 50 mM phosphate buffer 7 35Β°C 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside Fluoride ion , pNP-Ξ²-D-Glc-Glc β€” β€” Classical aqueous control (in %)
E383A Activity + Stability - Product Formation Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC Dimethyl Sulfoxide (DMSO) 20 % v/v 100 β€” 98 % Digital Continuous 50 mM phosphate buffer 7 35Β°C 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside Fluoride ion , pNP-Ξ²-D-Glc-Glc β€” β€” Classical aqueous control (in %)
E383A Activity + Stability - Product Formation Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC Dimethyl Sulfoxide (DMSO) 30 % v/v 100 β€” 96 % Digital Continuous 50 mM phosphate buffer 7 35Β°C 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside Fluoride ion , pNP-Ξ²-D-Glc-Glc β€” β€” Classical aqueous control (in %)
E383A Activity + Stability - Product Formation Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC Dimethyl Sulfoxide (DMSO) 40 % v/v 100 β€” 62 % Digital Continuous 50 mM phosphate buffer 7 35Β°C 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside Fluoride ion , pNP-Ξ²-D-Glc-Glc β€” β€” Classical aqueous control (in %)

Mutations in this dataset (1)

E383A

Visualization : Activity + Stability β€” Product Formation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*