Ξ²-glucosidase from Streptomyces sp.
Enzyme Description
Sequence
MVPAAQQTATAPDAALTFPEGFLWGSATASYQIEGAAAEDGRTPSIWDTYARTPGRVRNGDTGDVATDHYHRWREDVALMAELGLGAYRFSLAWPRIQPTGRGPALQKGLDFYRRLADELLAKGIQPVATLYHWDLPQELENPGGWPERPTAERFAEYAAIAADALGDRVKTWTTLNEPWCSAFLGYGSGVHAPGRTDPVAALRAAHHLNLGHGLAVQALRDRLPADAQCSVTLNIHHVRPLTDSEADADAVRRIDALANRVFTGPMLQGAYPEDLVKDTAGLTDWSFVRDGDLRLAHQKLDFLGVNYYSPTLVSEADGSGTHNSDGHGRSAHSPWPGADRVAFHQPPGETTAMGWAVDPSGLYELLRRLSSDFPALPLVITENGAAFHDYADPEGNVNDPERIAYVRDHLAAVHRAIKDGSDVRGYFLWSLLDNFEWAHGYSKRFGAVYVDYPTGTRIPKASARWYAEVARTGVLPTA
Magda Faijes et al. (2006)
β Acceptor-dependent regioselectivity of glycosynthase reactions by Streptomyces E383A Ξ²-glucosidase
Carbohydrate Research
Β· doi:10.1016/j.carres.2006.04.049 β
Β· Activity + Stability - Product Formation
▼
Database ID
UniParc: UPI00000B411B β
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli
Experimental Data (9 measurements)
9 measurements
| Mutation | Property | Assay | Solvent | Solvent Volume | Aqueous Reference | WT Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| E383A | Activity + Stability - Product Formation | Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC | Acetonitrile | 5 % v/v | 100 | β | 100 | % | Digital | Continuous | 50 mM phosphate buffer | 7 | 35Β°C | 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | Fluoride ion , pNP-Ξ²-D-Glc-Glc | β | β | Classical aqueous control (in %) |
| E383A | Activity + Stability - Product Formation | Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC | Acetonitrile | 10 % v/v | 100 | β | 98 | % | Digital | Continuous | 50 mM phosphate buffer | 7 | 35Β°C | 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | Fluoride ion , pNP-Ξ²-D-Glc-Glc | β | β | Classical aqueous control (in %) |
| E383A | Activity + Stability - Product Formation | Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC | Acetonitrile | 20 % v/v | 100 | β | 14 | % | Digital | Continuous | 50 mM phosphate buffer | 7 | 35Β°C | 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | Fluoride ion , pNP-Ξ²-D-Glc-Glc | β | β | Classical aqueous control (in %) |
| E383A | Activity + Stability - Product Formation | Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC | Acetonitrile | 30 % v/v | 100 | β | 2 | % | Digital | Continuous | 50 mM phosphate buffer | 7 | 35Β°C | 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | Fluoride ion , pNP-Ξ²-D-Glc-Glc | β | β | Classical aqueous control (in %) |
| E383A | Activity + Stability - Product Formation | Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC | Acetonitrile | 40 % v/v | 100 | β | 2 | % | Digital | Continuous | 50 mM phosphate buffer | 7 | 35Β°C | 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | Fluoride ion , pNP-Ξ²-D-Glc-Glc | β | β | Classical aqueous control (in %) |
| E383A | Activity + Stability - Product Formation | Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100 | β | 98 | % | Digital | Continuous | 50 mM phosphate buffer | 7 | 35Β°C | 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | Fluoride ion , pNP-Ξ²-D-Glc-Glc | β | β | Classical aqueous control (in %) |
| E383A | Activity + Stability - Product Formation | Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 100 | β | 98 | % | Digital | Continuous | 50 mM phosphate buffer | 7 | 35Β°C | 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | Fluoride ion , pNP-Ξ²-D-Glc-Glc | β | β | Classical aqueous control (in %) |
| E383A | Activity + Stability - Product Formation | Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100 | β | 96 | % | Digital | Continuous | 50 mM phosphate buffer | 7 | 35Β°C | 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | Fluoride ion , pNP-Ξ²-D-Glc-Glc | β | β | Classical aqueous control (in %) |
| E383A | Activity + Stability - Product Formation | Product formation after incubation (20 hours at 35Β°C) in the presence of organic solvent, measured by HPLC | Dimethyl Sulfoxide (DMSO) | 40 % v/v | 100 | β | 62 | % | Digital | Continuous | 50 mM phosphate buffer | 7 | 35Β°C | 1 mM Glucosyl fluoride, 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | Fluoride ion , pNP-Ξ²-D-Glc-Glc | β | β | Classical aqueous control (in %) |
Mutations in this dataset (1)
E383A
Visualization : Activity + Stability β Product Formation
One bar per measurement. Colour = solvent, shade = solvent volume.