Esterase (gene EstR) from Ralstonia sp. M1

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 320 amino acids
MIQTVLIAVALVIAAPVAFTFVIARRVTKAFPPEGKFIDIGADRVHYTDRGQGPAIVFVHGLCGNLRNFAYLDLERLAQSHRVIVIDRPGSGRSLRGAASTANIYAQARTVAQCIQKLGLDQPVLVGHSLGGAIALAVGLNHPQSVRRLALVAPLTHNEHAPPGAFKGLALTSPLARRLVSWTLAVPLSILNSRKAIAAVFAPEAMPEDFPFKGGGLLGLRPHVFYAASSDLVAAPEDLPDMERRYASMTVPVDVLYGRGDRILNVKRQGEALKQKLERVNLRVVDGGHMLPVTQPALTTDWILGVAAAVPIQAEAAASA
Dinh Thi Quyen et al. (2007) β€” A novel esterase from Ralstonia sp. M1: Gene cloning, sequencing, high-level expression and characterization
Protein Expression and Purification  Β· doi:10.1016/j.pep.2006.06.009 β†—  Β· Stability - Incubation
26 measurements
Database ID
UniProt: Q6EIR0 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (26 measurements)

26 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Ethyl Acetate 10 % v/v 100 86 % Direct Continuous Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 55Β°C 10 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Dichloromethane 10 % v/v 100 116 % Direct Continuous Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 55Β°C 10 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase tert-Butanol 10 % v/v 100 86 % Direct Continuous Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 55Β°C 10 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase 1-Butanol 10 % v/v 100 19 % Direct Continuous Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 55Β°C 10 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Isopropanol 10 % v/v 100 90 % Direct Continuous Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 55Β°C 10 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Ethanol 10 % v/v 100 100 % Direct Continuous Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 55Β°C 10 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*