Esterase A from Paenarthrobacter nitroguajacolicus
Enzyme Description
Sequence
MHSQVIAPGFEPVAELFGVFLEQDPDYSAQVAAYHRGVKVLDLSGGPHIRPDSVTGVFSCSKGMAGLVMALLVQDGELDLEAEVVKYWPEFGVEGKSSITVAQLLSHRAGLLGVEGGLTLHEVNNSELAAAKLAELPPLWKPGTAFGYHALTIGIFMEELCRRITGSTLQEVFEQRIRAVTGANFYLGLPESEESRFAQFRWAADPSWPWVDPASHFGLAANAAVGDILDLPNIREVRAAGLSSAAGVASAEGMARIYAAALTGLEGKSAMPPLLTEETIRTVSAEQVFGIDRVFGETGCFGTVFMKSHTRMPFGSYRAFGHDGASASLGFADPVYELGFGYVPQTAEPGGVGCRNFQLSSAVREVIAGFAA
Marcus SchΓΌtte et al. (2007)
β EstA from Arthrobacter nitroguajacolicus RΓΌ61a, a Thermo- and Solvent-Tolerant Carboxylesterase Related to Class C Ξ²-Lactamases
Current Microbiology
Β· doi:10.1007/s00284-006-0438-2 β
Β· Stability - Incubation Activity + Stability - Incubation
▼
Database ID
UniProt: K4DIE4 β
Sequence Annotation
Explicit - provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3) pLysS
Experimental Data (14 measurements)
14 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity + Stability - Incubation | Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100 | 110 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: 22Β°C, Assay: 22Β°C | 5 mM Phenyl acetate | Acetic Acid , Phenol | β | Incubation: 200 rpm | Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%" |
| Activity + Stability - Incubation | Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), in the presence of organic solvent | Dimethylformamide (DMF) | 30 % v/v | 100 | 108 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: 22Β°C, Assay: 22Β°C | 5 mM Phenyl acetate | Acetic Acid , Phenol | β | Incubation: 200 rpm | Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%" |
| Activity + Stability - Incubation | Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), in the presence of organic solvent | Methanol | 30 % v/v | 100 | 115 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: 22Β°C, Assay: 22Β°C | 5 mM Phenyl acetate | Acetic Acid , Phenol | β | Incubation: 200 rpm | Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%" |
| Activity + Stability - Incubation | Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), in the presence of organic solvent | Acetonitrile | 30 % v/v | 100 | 120 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: 22Β°C, Assay: 22Β°C | 5 mM Phenyl acetate | Acetic Acid , Phenol | β | Incubation: 200 rpm | Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%" |
| Activity + Stability - Incubation | Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), in the presence of organic solvent | Ethanol | 30 % v/v | 100 | 90 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: 22Β°C, Assay: 22Β°C | 5 mM Phenyl acetate | Acetic Acid , Phenol | β | Incubation: 200 rpm | Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%" |
| Activity + Stability - Incubation | Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), in the presence of organic solvent | Acetone | 30 % v/v | 100 | 130 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: 22Β°C, Assay: 22Β°C | 5 mM Phenyl acetate | Acetic Acid , Phenol | β | Incubation: 200 rpm | Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%" |
| Activity + Stability - Incubation | Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), in the presence of organic solvent | 1-Propanol | 30 % v/v | 100 | 104 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: 22Β°C, Assay: 22Β°C | 5 mM Phenyl acetate | Acetic Acid , Phenol | β | Incubation: 200 rpm | Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%" |
| Stability - Incubation | Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), in the presence of organic solvent | Diethyl Ether | 30 % v/v | 100 | 124 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: 22Β°C, Assay: 22Β°C | 5 mM Phenyl acetate | Acetic Acid , Phenol | β | Incubation: 200 rpm | Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%" |
| Stability - Incubation | Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), without the presence of organic solvent | Chloroform | 5 % v/v | 100 | 0 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: 22Β°C, Assay: 22Β°C | 5 mM Phenyl acetate | Acetic Acid , Phenol | β | Incubation: 200 rpm | Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%" |
| Stability - Incubation | Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), without the presence of organic solvent | Toluene | 5 % v/v | 100 | 0 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: 22Β°C, Assay: 22Β°C | 5 mM Phenyl acetate | Acetic Acid , Phenol | β | Incubation: 200 rpm | Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%" |
| Stability - Incubation | Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), without the presence of organic solvent | n-Hexane | 5 % v/v | 100 | 0 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: 22Β°C, Assay: 22Β°C | 5 mM Phenyl acetate | Acetic Acid , Phenol | β | Incubation: 200 rpm | Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%" |
| Stability - Incubation | Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), without the presence of organic solvent | n-Octane | 5 % v/v | 100 | 0 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: 22Β°C, Assay: 22Β°C | 5 mM Phenyl acetate | Acetic Acid , Phenol | β | Incubation: 200 rpm | Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%" |
| Stability - Incubation | Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), without the presence of organic solvent | n-Dodecane | 5 % v/v | 100 | 0 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: 22Β°C, Assay: 22Β°C | 5 mM Phenyl acetate | Acetic Acid , Phenol | β | Incubation: 200 rpm | Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%" |
| Stability - Incubation | Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), without the presence of organic solvent | n-Hexadecane | 5 % v/v | 100 | 51 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: 22Β°C, Assay: 22Β°C | 5 mM Phenyl acetate | Acetic Acid , Phenol | β | Incubation: 200 rpm | Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%" |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Activity + Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.