Papain with nitrile hydratase activity from Carica papaya
Enzyme Description
Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Andrea Versari et al. (2002)
β Enzymatic hydrolysis of nitrides by an engineered nitrile hydratase (Papain Gln19Glu) in aqueous-organic media
Biotechnology and Bioengineering
Β· doi:10.1002/bit.10267 β
Β· Activity - Michaelis-Menten
▼
Database ID
UniProt: P00784 β
Sequence Annotation
Inferred - from protein name (132 first residues from UniProt sequence removed from mature protein, presence of 1 mutation compared to UniProt)
Protein Source
Recombinant, host yeast Pichia pastoris
Experimental Data (5 measurements)
5 measurements
| Mutation | Property | Assay | Solvent | Solvent Volume | Aqueous Reference | WT Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Q19E | Activity - Michaelis-Menten | Vmax (in Β΅M/hr), measured in the presence of organic solvent by HPLC | Acetone | 10 % v/v | 0.0 | β | 6.8 | Β΅M/hr | Digital | Continuous | 50 mM citrate buffer, 2mM DTT, 1mM EDTA | 5 | 22Β°C | N-acetyl-L-phenylalanyl-L-alanine nitrile | N-acetyl-phenylalanyl-alanine amide | β | β | Classical aqueous control (in microM/hr) | Insoluble substrate in aqueous phase |
| Q19E | Activity - Michaelis-Menten | Vmax (in Β΅M/hr), measured in the presence of organic solvent by HPLC | Acetone | 20 % v/v | 0.0 | β | 6.7 | Β΅M/hr | Digital | Continuous | 50 mM citrate buffer, 2mM DTT, 1mM EDTA | 5 | 22Β°C | N-acetyl-L-phenylalanyl-L-alanine nitrile | N-acetyl-phenylalanyl-alanine amide | β | β | Classical aqueous control (in microM/hr) | Insoluble substrate in aqueous phase |
| Q19E | Activity - Michaelis-Menten | Vmax (in Β΅M/hr), measured in the presence of organic solvent by HPLC | Acetone | 30 % v/v | 0.0 | β | 4.9 | Β΅M/hr | Digital | Continuous | 50 mM citrate buffer, 2mM DTT, 1mM EDTA | 5 | 22Β°C | N-acetyl-L-phenylalanyl-L-alanine nitrile | N-acetyl-phenylalanyl-alanine amide | β | β | Classical aqueous control (in microM/hr) | Insoluble substrate in aqueous phase |
| Q19E | Activity - Michaelis-Menten | Vmax (in Β΅M/hr), measured in the presence of organic solvent by HPLC | Acetone | 40 % v/v | 0.0 | β | 3.6 | Β΅M/hr | Digital | Continuous | 50 mM citrate buffer, 2mM DTT, 1mM EDTA | 5 | 22Β°C | N-acetyl-L-phenylalanyl-L-alanine nitrile | N-acetyl-phenylalanyl-alanine amide | β | β | Classical aqueous control (in microM/hr) | Insoluble substrate in aqueous phase |
| Q19E | Activity - Michaelis-Menten | Vmax (in Β΅M/hr), measured in the presence of organic solvent by HPLC | Acetone | 50 % v/v | 0.0 | β | 2.7 | Β΅M/hr | Digital | Continuous | 50 mM citrate buffer, 2mM DTT, 1mM EDTA | 5 | 22Β°C | N-acetyl-L-phenylalanyl-L-alanine nitrile | N-acetyl-phenylalanyl-alanine amide | β | β | Classical aqueous control (in microM/hr) | Insoluble substrate in aqueous phase |
Mutations in this dataset (1)
Q19E
Visualization : Activity β Michaelis-Menten
One bar per measurement. Colour = solvent, shade = solvent volume.