Papain with nitrile hydratase activity from Carica papaya

Enzyme Description

Extremophile
No
EC Number
4.2.1.84 β†— (standard : 3.4.22.2)

Sequence

Length: 212 amino acids
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Andrea Versari et al. (2002) β€” Enzymatic hydrolysis of nitrides by an engineered nitrile hydratase (Papain Gln19Glu) in aqueous-organic media
Biotechnology and Bioengineering  Β· doi:10.1002/bit.10267 β†—  Β· Activity - Michaelis-Menten
5 measurements
Database ID
UniProt: P00784 β†—
Sequence Annotation
Inferred - from protein name (132 first residues from UniProt sequence removed from mature protein, presence of 1 mutation compared to UniProt)
Protein Source
Recombinant, host yeast Pichia pastoris

Experimental Data (5 measurements)

5 measurements
Mutation Property Assay Solvent Solvent Volume Aqueous ReferenceWT Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Q19E Activity - Michaelis-Menten Vmax (in Β΅M/hr), measured in the presence of organic solvent by HPLC Acetone 10 % v/v 0.0 β€” 6.8 Β΅M/hr Digital Continuous 50 mM citrate buffer, 2mM DTT, 1mM EDTA 5 22Β°C N-acetyl-L-phenylalanyl-L-alanine nitrile N-acetyl-phenylalanyl-alanine amide β€” β€” Classical aqueous control (in microM/hr) | Insoluble substrate in aqueous phase
Q19E Activity - Michaelis-Menten Vmax (in Β΅M/hr), measured in the presence of organic solvent by HPLC Acetone 20 % v/v 0.0 β€” 6.7 Β΅M/hr Digital Continuous 50 mM citrate buffer, 2mM DTT, 1mM EDTA 5 22Β°C N-acetyl-L-phenylalanyl-L-alanine nitrile N-acetyl-phenylalanyl-alanine amide β€” β€” Classical aqueous control (in microM/hr) | Insoluble substrate in aqueous phase
Q19E Activity - Michaelis-Menten Vmax (in Β΅M/hr), measured in the presence of organic solvent by HPLC Acetone 30 % v/v 0.0 β€” 4.9 Β΅M/hr Digital Continuous 50 mM citrate buffer, 2mM DTT, 1mM EDTA 5 22Β°C N-acetyl-L-phenylalanyl-L-alanine nitrile N-acetyl-phenylalanyl-alanine amide β€” β€” Classical aqueous control (in microM/hr) | Insoluble substrate in aqueous phase
Q19E Activity - Michaelis-Menten Vmax (in Β΅M/hr), measured in the presence of organic solvent by HPLC Acetone 40 % v/v 0.0 β€” 3.6 Β΅M/hr Digital Continuous 50 mM citrate buffer, 2mM DTT, 1mM EDTA 5 22Β°C N-acetyl-L-phenylalanyl-L-alanine nitrile N-acetyl-phenylalanyl-alanine amide β€” β€” Classical aqueous control (in microM/hr) | Insoluble substrate in aqueous phase
Q19E Activity - Michaelis-Menten Vmax (in Β΅M/hr), measured in the presence of organic solvent by HPLC Acetone 50 % v/v 0.0 β€” 2.7 Β΅M/hr Digital Continuous 50 mM citrate buffer, 2mM DTT, 1mM EDTA 5 22Β°C N-acetyl-L-phenylalanyl-L-alanine nitrile N-acetyl-phenylalanyl-alanine amide β€” β€” Classical aqueous control (in microM/hr) | Insoluble substrate in aqueous phase

Mutations in this dataset (1)

Q19E

Visualization : Activity β€” Michaelis-Menten

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*