Alcohol dehydrogenase from Picrophilus torridus DSM 9790
Enzyme Description
Extremophile
Yes
"extreme thermoacidophilic" organism
EC Number
Sequence
MRAIVLERFGIENIKIEDIDDESPGIPVKITMAGLNPVDYSTVNGNIMYGVKPMPHVPGSEAIGIAMADGNYIKRGDRVIIYNRIFDGTCEQCIKGNEHLCLNGGILGVASNGVYREMIKLPEMNLFKIPDSIDDHVAASMGVGALTAYRALKTMNIEAGKTILVYGAGNTGIFTAQLARIFGLETYVVSRKKDLERYNINVLDSVPEDFKADYIINPLGGSIFEESLRHIKTGGKIVTFGILTGREAKIDIGSLYANEIKIYGSTGGTRKDLLELIKIISMNRIYLPVEKTFSLWDLKEAMNYFKNRSTGRILLKA
Matthias Hess et al. (2008)
β Archaeal alcohol dehydrogenase active at increased temperatures and in the presence of organic solvents
Applied Microbiology and Biotechnology
Β· doi:10.1007/s00253-007-1238-8 β
Β· Activity + Stability - Incubation
▼
Database ID
UniProt: Q6L0S1 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli RosettaTM (DE3) placI
Experimental Data (10 measurements)
10 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Acetone | 50 % v/v | 100 | 18 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 7.8, Assay: 7.8 | Incubation: Room temperature, Assay: 83Β°C | 1 mM Ethanol | Acetaldehyde | 1.5 mM NAD+ | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 100 | 71 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 7.8, Assay: 7.8 | Incubation: Room temperature, Assay: 83Β°C | 1 mM Ethanol | Acetaldehyde | 1.5 mM NAD+ | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Ethanol | 50 % v/v | 100 | 41 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 7.8, Assay: 7.8 | Incubation: Room temperature, Assay: 83Β°C | 1 mM Ethanol | Acetaldehyde | 1.5 mM NAD+ | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Isopropanol | 50 % v/v | 100 | 12 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 7.8, Assay: 7.8 | Incubation: Room temperature, Assay: 83Β°C | 1 mM Ethanol | Acetaldehyde | 1.5 mM NAD+ | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Methanol | 50 % v/v | 100 | 70 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 7.8, Assay: 7.8 | Incubation: Room temperature, Assay: 83Β°C | 1 mM Ethanol | Acetaldehyde | 1.5 mM NAD+ | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | tert-Butanol | 50 % v/v | 100 | 8 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 7.8, Assay: 7.8 | Incubation: Room temperature, Assay: 83Β°C | 1 mM Ethanol | Acetaldehyde | 1.5 mM NAD+ | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | n-Heptane | 90 % v/v | 100 | 1 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 7.8, Assay: 7.8 | Incubation: Room temperature, Assay: 83Β°C | 1 mM Ethanol | Acetaldehyde | 1.5 mM NAD+ | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | n-Hexadecane | 90 % v/v | 100 | 29 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 7.8, Assay: 7.8 | Incubation: Room temperature, Assay: 83Β°C | 1 mM Ethanol | Acetaldehyde | 1.5 mM NAD+ | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Isooctane | 90 % v/v | 100 | 2 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 7.8, Assay: 7.8 | Incubation: Room temperature, Assay: 83Β°C | 1 mM Ethanol | Acetaldehyde | 1.5 mM NAD+ | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Toluene | 90 % v/v | 100 | 3 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 7.8, Assay: 7.8 | Incubation: Room temperature, Assay: 83Β°C | 1 mM Ethanol | Acetaldehyde | 1.5 mM NAD+ | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ") |
Visualization : Activity + Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.