Alcohol dehydrogenase from Picrophilus torridus DSM 9790

Enzyme Description

Extremophile
Yes "extreme thermoacidophilic" organism
EC Number

Sequence

Length: 317 amino acids
MRAIVLERFGIENIKIEDIDDESPGIPVKITMAGLNPVDYSTVNGNIMYGVKPMPHVPGSEAIGIAMADGNYIKRGDRVIIYNRIFDGTCEQCIKGNEHLCLNGGILGVASNGVYREMIKLPEMNLFKIPDSIDDHVAASMGVGALTAYRALKTMNIEAGKTILVYGAGNTGIFTAQLARIFGLETYVVSRKKDLERYNINVLDSVPEDFKADYIINPLGGSIFEESLRHIKTGGKIVTFGILTGREAKIDIGSLYANEIKIYGSTGGTRKDLLELIKIISMNRIYLPVEKTFSLWDLKEAMNYFKNRSTGRILLKA
Matthias Hess et al. (2008) β€” Archaeal alcohol dehydrogenase active at increased temperatures and in the presence of organic solvents
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-007-1238-8 β†—  Β· Activity + Stability - Incubation
10 measurements
Database ID
UniProt: Q6L0S1 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli RosettaTM (DE3) placI

Experimental Data (10 measurements)

10 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetone 50 % v/v 100 18 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 7.8, Assay: 7.8 Incubation: Room temperature, Assay: 83Β°C 1 mM Ethanol Acetaldehyde 1.5 mM NAD+ β€” Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ")
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50 % v/v 100 71 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 7.8, Assay: 7.8 Incubation: Room temperature, Assay: 83Β°C 1 mM Ethanol Acetaldehyde 1.5 mM NAD+ β€” Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ")
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 50 % v/v 100 41 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 7.8, Assay: 7.8 Incubation: Room temperature, Assay: 83Β°C 1 mM Ethanol Acetaldehyde 1.5 mM NAD+ β€” Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ")
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 50 % v/v 100 12 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 7.8, Assay: 7.8 Incubation: Room temperature, Assay: 83Β°C 1 mM Ethanol Acetaldehyde 1.5 mM NAD+ β€” Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ")
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 50 % v/v 100 70 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 7.8, Assay: 7.8 Incubation: Room temperature, Assay: 83Β°C 1 mM Ethanol Acetaldehyde 1.5 mM NAD+ β€” Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ")
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent tert-Butanol 50 % v/v 100 8 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 7.8, Assay: 7.8 Incubation: Room temperature, Assay: 83Β°C 1 mM Ethanol Acetaldehyde 1.5 mM NAD+ β€” Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ")
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Heptane 90 % v/v 100 1 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 7.8, Assay: 7.8 Incubation: Room temperature, Assay: 83Β°C 1 mM Ethanol Acetaldehyde 1.5 mM NAD+ β€” Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ")
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Hexadecane 90 % v/v 100 29 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 7.8, Assay: 7.8 Incubation: Room temperature, Assay: 83Β°C 1 mM Ethanol Acetaldehyde 1.5 mM NAD+ β€” Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ")
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Isooctane 90 % v/v 100 2 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 7.8, Assay: 7.8 Incubation: Room temperature, Assay: 83Β°C 1 mM Ethanol Acetaldehyde 1.5 mM NAD+ β€” Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ")
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Toluene 90 % v/v 100 3 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 7.8, Assay: 7.8 Incubation: Room temperature, Assay: 83Β°C 1 mM Ethanol Acetaldehyde 1.5 mM NAD+ β€” Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent. ")

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*