Esterase A from Picrophilus torridus DSM 9790
Enzyme Description
Extremophile
Yes
extremely thermoacidophilic organism
EC Number
Sequence
MIDDMYTEVHSKKVHYIESGNGKPFLLFHGARFNARTWEETGTIDALSGAGFRAISVDFPGFGKSDRSDQNLPDFINEFIDAMGLEKPIVLGASMGGEAVLGFSVKYENYSGIVLVGAVGVSQYENELNKISGKPFLLIWGKNDMVSSPANYQMLMKYNKDAKFINVGYQHACYLDDNKSFNNEIVNFAKSL
Matthias Hess et al. (2008)
β Extremely thermostable esterases from the thermoacidophilic euryarchaeon Picrophilus torridus
Extremophiles
Β· doi:10.1007/s00792-008-0139-9 β
Β· Activity + Stability - Incubation
▼
Database ID
UniProt: Q6L0C9 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli RosettaTM (DE3)
Experimental Data (26 measurements)
26 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Pyridine | 90 % v/v | 100 | 0 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Toluene | 90 % v/v | 100 | 199 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | n-Hexane | 90 % v/v | 100 | 43 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | 1-Decanol | 90 % v/v | 100 | 0 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Isooctane | 90 % v/v | 100 | 0 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | n-Hexadecane | 90 % v/v | 100 | 61 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | n-Heptane | 90 % v/v | 100 | 0 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Formaldehyde | 90 % v/v | 100 | 0 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Chloroform | 90 % v/v | 100 | 33 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Benzene | 90 % v/v | 100 | 43 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | 1-Pentanol | 90 % v/v | 100 | 0 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | tert-Butanol | 90 % v/v | 100 | 113 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | tert-Butanol | 50 % v/v | 100 | 71 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Acetone | 50 % v/v | 100 | 82 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Pyridine | 50 % v/v | 100 | 6 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Methanol | 90 % v/v | 100 | 27 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Methanol | 50 % v/v | 100 | 78 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Isopropanol | 90 % v/v | 100 | 53 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Isopropanol | 50 % v/v | 100 | 63 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
| Activity + Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Ethanol | 90 % v/v | 100 | 0 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic | Incubation: 7, Assay: 7 | Incubation: Room temperature, Assay: 70Β°C | 2 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.") |
Visualization : Activity + Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.