Alcohol dehydrogenase from Thermus sp. ATN1

Enzyme Description

Species
Thermus sp. ATN1 β†—
Extremophile
Yes thermophilic organism
EC Number
1.1.1.1 β†—

Sequence

Length: 347 amino acids
MRAVVFENKERVAVKEVNAPRLQHPLDALVRVHLAGICGSDLHLYHGKIPVLPGSVLGHEFVGQVEAVGEGIQDLQPGDWVVGPFHIACGTCPYCRRHQYNLCERGGVYGYGPMFGNLQGAQAEILRVPFSNVNLRKLPPNLSPERAIFAGDILSTAYGGLIQGQLRPGDSVAVIGAGPVGLMAIEVAQVLGASKILAIDRIPERLERAASLGAIPINAEQENPVRRVRSETNDEGPDLVLEAVGGAATLSLALEMVRPGGRVSAVGVDNAPSFPFPLASGLVKDLTFRIGLANVHLYIDAVLALLASGRLQPERIVSHYLPLEEAPRGYELFDRKEALKVLLVVRG
Volker HΓΆllrigl et al. (2008) β€” TADH, the thermostable alcohol dehydrogenase from Thermus sp. ATN1: a versatile new biocatalyst for organic synthesis
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-008-1606-z β†—  Β· Activity - Classical
12 measurements ▼
Database ID
UniProt: B2ZRE3 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 pLysS pASZ2

Experimental Data (12 measurements)

12 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10 % v/v 100 20 % Digital Continuous 200 mM bicine 9 60Β°C 10 mM Cyclohexanol Cyclohexanone 1 mM NAD+ 500 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 10 % v/v 100 9 % Digital Continuous 200 mM bicine 9 60Β°C 10 mM Cyclohexanol Cyclohexanone 1 mM NAD+ 500 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 10 % v/v 100 34 % Digital Continuous 200 mM bicine 9 60Β°C 10 mM Cyclohexanol Cyclohexanone 1 mM NAD+ 500 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 10 % v/v 100 28 % Digital Continuous 200 mM bicine 9 60Β°C 10 mM Cyclohexanol Cyclohexanone 1 mM NAD+ 500 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetone 10 % v/v 100 52 % Digital Continuous 200 mM bicine 9 60Β°C 10 mM Cyclohexanol Cyclohexanone 1 mM NAD+ 500 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 10 % v/v 100 19 % Digital Continuous 200 mM bicine 9 60Β°C 10 mM Cyclohexanol Cyclohexanone 1 mM NAD+ 500 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethyl Acetate 50 % v/v 100 14 % Digital Continuous 200 mM bicine 9 60Β°C 10 mM Cyclohexanol Cyclohexanone 1 mM NAD+ 500 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Toluene 50 % v/v 100 37 % Digital Continuous 200 mM bicine 9 60Β°C 10 mM Cyclohexanol Cyclohexanone 1 mM NAD+ 500 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent 1-Octanol 50 % v/v 100 39 % Digital Continuous 200 mM bicine 9 60Β°C 10 mM Cyclohexanol Cyclohexanone 1 mM NAD+ 500 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Hexane 50 % v/v 100 73 % Digital Continuous 200 mM bicine 9 60Β°C 10 mM Cyclohexanol Cyclohexanone 1 mM NAD+ 500 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Octane 50 % v/v 100 72 % Digital Continuous 200 mM bicine 9 60Β°C 10 mM Cyclohexanol Cyclohexanone 1 mM NAD+ 500 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Hexadecane 50 % v/v 100 32 % Digital Continuous 200 mM bicine 9 60Β°C 10 mM Cyclohexanol Cyclohexanone 1 mM NAD+ 500 rpm Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*