Alcohol dehydrogenase from Thermus sp. ATN1
Enzyme Description
Sequence
MRAVVFENKERVAVKEVNAPRLQHPLDALVRVHLAGICGSDLHLYHGKIPVLPGSVLGHEFVGQVEAVGEGIQDLQPGDWVVGPFHIACGTCPYCRRHQYNLCERGGVYGYGPMFGNLQGAQAEILRVPFSNVNLRKLPPNLSPERAIFAGDILSTAYGGLIQGQLRPGDSVAVIGAGPVGLMAIEVAQVLGASKILAIDRIPERLERAASLGAIPINAEQENPVRRVRSETNDEGPDLVLEAVGGAATLSLALEMVRPGGRVSAVGVDNAPSFPFPLASGLVKDLTFRIGLANVHLYIDAVLALLASGRLQPERIVSHYLPLEEAPRGYELFDRKEALKVLLVVRG
Volker HΓΆllrigl et al. (2008)
β TADH, the thermostable alcohol dehydrogenase from Thermus sp. ATN1: a versatile new biocatalyst for organic synthesis
Applied Microbiology and Biotechnology
Β· doi:10.1007/s00253-008-1606-z β
Β· Activity - Classical
▼
Database ID
UniProt: B2ZRE3 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 pLysS pASZ2
Experimental Data (12 measurements)
12 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100 | 20 | % | Digital | Continuous | 200 mM bicine | 9 | 60Β°C | 10 mM Cyclohexanol | Cyclohexanone | 1 mM NAD+ | 500 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 10 % v/v | 100 | 9 | % | Digital | Continuous | 200 mM bicine | 9 | 60Β°C | 10 mM Cyclohexanol | Cyclohexanone | 1 mM NAD+ | 500 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Methanol | 10 % v/v | 100 | 34 | % | Digital | Continuous | 200 mM bicine | 9 | 60Β°C | 10 mM Cyclohexanol | Cyclohexanone | 1 mM NAD+ | 500 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Ethanol | 10 % v/v | 100 | 28 | % | Digital | Continuous | 200 mM bicine | 9 | 60Β°C | 10 mM Cyclohexanol | Cyclohexanone | 1 mM NAD+ | 500 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Acetone | 10 % v/v | 100 | 52 | % | Digital | Continuous | 200 mM bicine | 9 | 60Β°C | 10 mM Cyclohexanol | Cyclohexanone | 1 mM NAD+ | 500 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Isopropanol | 10 % v/v | 100 | 19 | % | Digital | Continuous | 200 mM bicine | 9 | 60Β°C | 10 mM Cyclohexanol | Cyclohexanone | 1 mM NAD+ | 500 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Ethyl Acetate | 50 % v/v | 100 | 14 | % | Digital | Continuous | 200 mM bicine | 9 | 60Β°C | 10 mM Cyclohexanol | Cyclohexanone | 1 mM NAD+ | 500 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Toluene | 50 % v/v | 100 | 37 | % | Digital | Continuous | 200 mM bicine | 9 | 60Β°C | 10 mM Cyclohexanol | Cyclohexanone | 1 mM NAD+ | 500 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | 1-Octanol | 50 % v/v | 100 | 39 | % | Digital | Continuous | 200 mM bicine | 9 | 60Β°C | 10 mM Cyclohexanol | Cyclohexanone | 1 mM NAD+ | 500 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | n-Hexane | 50 % v/v | 100 | 73 | % | Digital | Continuous | 200 mM bicine | 9 | 60Β°C | 10 mM Cyclohexanol | Cyclohexanone | 1 mM NAD+ | 500 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | n-Octane | 50 % v/v | 100 | 72 | % | Digital | Continuous | 200 mM bicine | 9 | 60Β°C | 10 mM Cyclohexanol | Cyclohexanone | 1 mM NAD+ | 500 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | n-Hexadecane | 50 % v/v | 100 | 32 | % | Digital | Continuous | 200 mM bicine | 9 | 60Β°C | 10 mM Cyclohexanol | Cyclohexanone | 1 mM NAD+ | 500 rpm | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.