Carboxylesterase (gene BioHs) from Serratia sp. SES-01
Enzyme Description
Sequence
MSALYWQTIGEGDRDLVLLHGWGLNAEVWHCMIERLTPHFRLHLVDLPGYGRSLGFGPMSLEQMAETVMAAAPAKAWWLGWSLGGLVASQIALLQPQRVSGLITVASSPCFAAQDDWPGIRPEVLSGFQHQLGQDFQRTVERFLALQTLGTQSARQDARLLKSVVLNQPMPSVEVLNGGLEILRTADLRQPLAKLPLPLLRVYGYLDGLVPRKVAGLLDVSWPNSPSIIIAKAAHAPFISQPDEFAEIIGTFVAENGI
Min-A Kwon et al. (2009)
β Gene Cloning, Expression, and Characterization of a New Carboxylesterase from Serratia sp. SES-01: Comparison with Escherichia coli BioHe Enzyme
Journal of Microbiology and Biotechnology
Β· doi:10.4014/jmb.0804.287 β
Β· Activity + Stability - Incubation
▼
Database ID
UniProt: B0M0H6 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 JM109
Experimental Data (21 measurements)
21 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | 1-Butanol | 20 % v/v | 100 | 14 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100 | 76 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 30 % v/v | 100 | 4 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 30 % v/v | 100 | 3 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | 1-Butanol | 30 % v/v | 100 | 5 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 30 % v/v | 100 | 4 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 30 % v/v | 100 | 5 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 30 % v/v | 100 | 2 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 100 | 90 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 20 % v/v | 100 | 31 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 20 % v/v | 100 | 19 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 10 % v/v | 100 | 93 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 20 % v/v | 100 | 25 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 20 % v/v | 100 | 41 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 20 % v/v | 100 | 71 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100 | 93 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 10 % v/v | 100 | 88 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 10 % v/v | 100 | 66 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | 1-Butanol | 10 % v/v | 100 | 27 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 20Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 10 % v/v | 100 | 84 | % | Direct | Continuous | Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol | Incubation: ?, Assay: 8.5 | Incubation: 20Β°C, Assay: 45Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent |
Visualization : Activity + Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.