Lipase from Pseudomonas aeruginosa LST-03

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 285 amino acids
STYTQTKYPIVLAHGMLGFDNILGVDYWFGIPSALRRDGAQVYVTEVSQLDTSEVRGEQLLQQVEEIVALSGQPKVNLIGHSHGGPTIRYVAAVRPDLIASATSVGAPHKGSDTADFLRQIPPGSAGEAILSGLVNSLGALISFLSSGSTGTQNSLGSLESLNSEGAARFNAKYPQGIPTSACGEGAYKVNGVSYYSWSGSSPLTNFLDPSDAFLGASSLTFKNGTANDGLVGTCSSHLGMVIRDNYRMNHLDEVNQVFGLTSLFETSPVSVYRQHANRLKNASL
Takuya Kawata et al. (2009) β€” Enhancement of the organic solvent-stability of the LST-03 lipase by directed evolution
Biotechnology Progress  Β· doi:10.1002/btpr.264 β†—  Β· Stability - Incubation Stability - Half-life
37 measurements
Database ID
UniProt: A8QYB2 β†—
Sequence Annotation
Explicit - Provided (26 first residues from UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host bacterium Escherichia coli JM109

Experimental Data (37 measurements)

37 measurements β€” page 2 of 2
Mutation Property Assay Solvent Solvent Volume Aqueous ReferenceWT Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
L145H Stability - Half-life Half-life (in days), with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) n-Octane 25 % v/v β€” 6.6 6.8 days Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Classical aqueous control (in days)
S155L/G157R/G177V/S194R/S202W/D209N Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) in the presence of organic solvent n-Decane 25 % v/v 1.0 0.22 0.47 relative units Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Non-incubated control (in relative units) in the presence of organic solvent, assay in the presence of organic solvent | Uncertainty about whether activity and control were really measured in the presence of organic solvent
S155L Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) in the presence of organic solvent n-Decane 25 % v/v 1.0 0.22 0.28 relative units Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Non-incubated control (in relative units) in the presence of organic solvent, assay in the presence of organic solvent | Uncertainty about whether activity and control were really measured in the presence of organic solvent
S164K/Y188F/S211R Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) in the presence of organic solvent n-Decane 25 % v/v 1.0 0.22 0.8 relative units Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Non-incubated control (in relative units) in the presence of organic solvent, assay in the presence of organic solvent | Uncertainty about whether activity and control were really measured in the presence of organic solvent
L145H Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) in the presence of organic solvent n-Decane 25 % v/v 1.0 β€” 0.22 relative units Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Non-incubated control (in relative units) in the presence of organic solvent, assay in the presence of organic solvent | Uncertainty about whether activity and control were really measured in the presence of organic solvent
S155L Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) in the presence of organic solvent n-Octane 25 % v/v 1.0 0.22 0.82 relative units Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Non-incubated control (in relative units) in the presence of organic solvent, assay in the presence of organic solvent | Uncertainty about whether activity and control were really measured in the presence of organic solvent
S164K/Y188F/S211R Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) in the presence of organic solvent n-Octane 25 % v/v 1.0 0.22 0.65 relative units Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Non-incubated control (in relative units) in the presence of organic solvent, assay in the presence of organic solvent | Uncertainty about whether activity and control were really measured in the presence of organic solvent
R88 Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) in the presence of organic solvent n-Octane 25 % v/v 1.0 0.22 0.43 relative units Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Non-incubated control (in relative units) in the presence of organic solvent, assay in the presence of organic solvent | Uncertainty about whether activity and control were really measured in the presence of organic solvent
L145H Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) in the presence of organic solvent n-Octane 25 % v/v 1.0 β€” 0.22 relative units Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Non-incubated control (in relative units) in the presence of organic solvent, assay in the presence of organic solvent | Uncertainty about whether activity and control were really measured in the presence of organic solvent
S164K/Y188F/S211R Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) in the presence of organic solvent Cyclohexane 25 % v/v 1.0 0.29 0.83 relative units Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Non-incubated control (in relative units) in the presence of organic solvent, assay in the presence of organic solvent | Uncertainty about whether activity and control were really measured in the presence of organic solvent
S155L/G157R/G177V/S194R/S202W/D209N Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) in the presence of organic solvent Cyclohexane 25 % v/v 1.0 0.29 0.82 relative units Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Non-incubated control (in relative units) in the presence of organic solvent, assay in the presence of organic solvent | Uncertainty about whether activity and control were really measured in the presence of organic solvent
S155L Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) in the presence of organic solvent Cyclohexane 25 % v/v 1.0 0.29 0.48 relative units Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Non-incubated control (in relative units) in the presence of organic solvent, assay in the presence of organic solvent | Uncertainty about whether activity and control were really measured in the presence of organic solvent
L145H Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) in the presence of organic solvent Cyclohexane 25 % v/v 1.0 0.29 0.32 relative units Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Non-incubated control (in relative units) in the presence of organic solvent, assay in the presence of organic solvent | Uncertainty about whether activity and control were really measured in the presence of organic solvent
L145H Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25 % v/v 1.0 0.66 0.4 relative units Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Non-incubated control (in relative units) in the presence of organic solvent, assay in the presence of organic solvent | Uncertainty about whether activity and control were really measured in the presence of organic solvent
S164K/Y188F/S211R Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25 % v/v 1.0 0.66 0.43 relative units Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Non-incubated control (in relative units) in the presence of organic solvent, assay in the presence of organic solvent | Uncertainty about whether activity and control were really measured in the presence of organic solvent
S155L Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25 % v/v 1.0 0.66 0.59 relative units Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Non-incubated control (in relative units) in the presence of organic solvent, assay in the presence of organic solvent | Uncertainty about whether activity and control were really measured in the presence of organic solvent
S155L/G157R/G177V/S194R/S202W/D209N Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25 % v/v 1.0 β€” 0.66 relative units Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl , 0.3 mM DTNB Incubation: 8.5, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM 2,3-Dimercapto-1-propanol tributyrate butyrate , Free thiols β€” Incubation: 160 rpm Non-incubated control (in relative units) in the presence of organic solvent, assay in the presence of organic solvent | Uncertainty about whether activity and control were really measured in the presence of organic solvent
1 2
Next β€Ί

Mutations in this dataset (6) β€” Takuya Kawata et al. (2009)

WT R88 L145H S155L S155L/G157R/G177V/S194R/S202W/D209N S164K/Y188F/S211R

Visualization : Stability β€” Incubation

Takuya Kawata et al. (2009)

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Visualization : Stability β€” Half-life

Takuya Kawata et al. (2009)

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Takuya Kawata et al. (2010) β€” Amino acid residues involved in organic solvent-stability of the LST-03 lipase
Biochemical and Biophysical Research Communications  Β· doi:10.1016/j.bbrc.2010.08.080 β†—  Β· Stability - Half-life
130 measurements

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*