Lipase from Pseudomonas aeruginosa CS-2
Enzyme Description
Sequence
MKKKSLLPLGLAIGLASLAASPLIQASTYTQTKYPIVLAHGMLGFDNILGVDYWFGIPSALRRDGAQVYVTEVSQLDTSEVRGEQLLQQVEEIVALSGQPKVNLIGHSHGGPTIRYVAAVRPDLIASATSVGAPHKGSDTADFLRQIPPGSAGEAILSGLVNSLGALISFLSSGSTGTQNSLGSLESLNSEGAARFNAKYPQGVPTSACGEGAYKVNGVSYYSWSGSSPLTNFLDPSDAFLGASSLTFKNGTANDGLVGTCSSHLGMVIRDNYRMNHLDEVNQVFGLTSLFETSPVSVYRQHANRLKNASLWDPGRG
Ren Peng et al. (2009)
β Purification and Characterization of an Organic Solvent-Tolerant Lipase from Pseudomonas aeruginosa CS-2
Applied Biochemistry and Biotechnology
Β· doi:10.1007/s12010-009-8841-3 β
Β· Stability - Incubation
▼
Database ID
UniProt: D8L9W5 β
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, bacterium Pseudomonas aeruginosa CS-2
Experimental Data (20 measurements)
20 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (9 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 100.0 | 56.0 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (9 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Isooctane | 50 % v/v | 100.0 | 57.4 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (9 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Petroleum Ether | 50 % v/v | 100.0 | 72.7 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (9 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | n-Hexane | 50 % v/v | 100.0 | 69.4 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (9 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Chloroform | 50 % v/v | 100.0 | 52.2 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (9 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Benzene | 50 % v/v | 100.0 | 62.2 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (9 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetonitrile | 50 % v/v | 100.0 | 130.6 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (9 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetone | 50 % v/v | 100.0 | 22.4 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (9 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Ethanol | 50 % v/v | 100.0 | 8.9 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (9 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Methanol | 50 % v/v | 100.0 | 6.9 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (3 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 100.0 | 65.7 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (3 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Isooctane | 50 % v/v | 100.0 | 75.0 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (3 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Petroleum Ether | 50 % v/v | 100.0 | 79.4 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (3 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | n-Hexane | 50 % v/v | 100.0 | 86.4 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (3 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Chloroform | 50 % v/v | 100.0 | 67.1 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (3 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Benzene | 50 % v/v | 100.0 | 79.2 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (3 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetonitrile | 50 % v/v | 100.0 | 139.8 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (3 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetone | 50 % v/v | 100.0 | 45.4 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (3 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Ethanol | 50 % v/v | 100.0 | 13.5 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (3 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Methanol | 50 % v/v | 100.0 | 10.2 | % | Direct | Continuous | Incubation: 20 mM Tris-HCl, Assay: 40 mM Tris-HCl, 20% Isopropanol | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 4 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.