Ene-reductase from Thermoanaerobacter pseudethanolicus E39

Enzyme Description

Extremophile
Yes "thermophilic" organism
EC Number

Sequence

Length: 337 amino acids
MSILHMPLKIKDITIKNRIMMSPMCMYSASTDGMPNDWHIVHYATRAIGGVGLIMQEATAVESRGRITDHDLGIWNDEQVKELKKIVDICKANGAVMGIQLAHAGRKCNISYEDVVGPSPIKAGDRYKLPRELSVEEIKSIVKAFGEAAKRANLAGYDVVEIHAAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEVRKNWPENKPIFVRVSADDYMEGGINIDMMVEYINMIKDKVDLIDVSSGGLLNVDINLYPGYQVKYAETIKKRCNIKTSAVGLITTQELAEEILSNERADLVALGRELLRNPYWVLHTYTSKEDWPKQYERAFKK
BjΓΆrn V. AdalbjΓΆrnsson et al. (2010) β€” Biocatalysis with Thermostable Enzymes: Structure and Properties of a Thermophilic 'ene '-Reductase related to Old Yellow Enzyme
ChemBioChem  Β· doi:10.1002/cbic.200900570 β†—  Β· Activity + Stability - Product Formation Selectivity - Enantioselectivity
24 measurements
Database ID
UniProt: B0KAH1 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli

Experimental Data (24 measurements)

24 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Product Formation Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography Dimethylformamide (DMF) 10 % v/v 74 42 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography Dimethylformamide (DMF) 5 % v/v 74 64 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography Acetonitrile 10 % v/v 74 66 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography Acetone 10 % v/v 74 36 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography 1-Propanol 10 % v/v 74 54 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography Ethanol 10 % v/v 74 65 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography Methanol 10 % v/v 74 66 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography Tetrahydrofuran (THF) 10 % v/v 74 69 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography Dimethylformamide (DMF) 10 % v/v 74 37 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography Dimethylformamide (DMF) 30 % v/v 74 12 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography Dimethylformamide (DMF) 20 % v/v 74 23 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography Dimethylformamide (DMF) 15 % v/v 74 32 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) after incubation (2 hours at 30Β°C in the presence of organic solvent, measured by gas chromatography Acetonitrile 10 % v/v 26 93 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) after incubation (2 hours at 30Β°C in the presence of organic solvent, measured by gas chromatography Acetone 10 % v/v 26 93 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) after incubation (2 hours at 30Β°C in the presence of organic solvent, measured by gas chromatography 1-Propanol 10 % v/v 26 90 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) after incubation (2 hours at 30Β°C in the presence of organic solvent, measured by gas chromatography Ethanol 10 % v/v 26 95 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) after incubation (2 hours at 30Β°C in the presence of organic solvent, measured by gas chromatography Methanol 10 % v/v 26 92 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) after incubation (2 hours at 30Β°C in the presence of organic solvent, measured by gas chromatography Tetrahydrofuran (THF) 10 % v/v 26 93 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) after incubation (2 hours at 30Β°C in the presence of organic solvent, measured by gas chromatography Dimethylformamide (DMF) 10 % v/v 26 93 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) after incubation (2 hours at 30Β°C in the presence of organic solvent, measured by gas chromatography Dimethylformamide (DMF) 30 % v/v 26 92 % Direct Continuous 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) 7 30Β°C 5 mM Ketoisophorone Levodione 6 mM NADH 130 rpm Classical aqueous control (in %)
β€Ή Prev
1 2

Visualization : Activity + Stability β€” Product Formation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*