Short-chain alcohol dehydrogenase from Thermococcus sibiricus
Enzyme Description
Species
Extremophile
Yes
"hyperthermophilic" organism
EC Number
Sequence
MKVAVITGASRGIGEAIARALARDGYALALGARSVDRLEKIAHELMQEQGVEVFYHHLDVSKAESVEEFSKKVLERFGDVDVVVANAGLGYFKRLEELSEEEFHEMIEVNLLGVWRTLKAFLDSLKRTGGLALVTTSDVSARLIPYGGGYVSTKWAARALVRTFQIENPDVRFFELRPGAVDTYFGGSKPGKPKEKGYLKPDEIAEAVRCLLKLPKDVRVEELMLRSVYQRPEY
Tatiana N. Stekhanova et al. (2010)
β Characterization of a Thermostable Short-Chain Alcohol Dehydrogenase from the Hyperthermophilic Archaeon Thermococcus sibiricus
Applied and Environmental Microbiology
Β· doi:10.1128/AEM.02797-09 β
Β· Activity - Classical Stability - Incubation
▼
Database ID
UniProt: C6A190 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta-gami (DE3)
Experimental Data (24 measurements)
24 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Ethyl Acetate | β | 100 | 0 | % | Direct | Continuous | 50 mM Gly-NaOH buffer without NaCl | 10.5 | 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | n-Decane | β | 100 | 107 | % | Direct | Continuous | 50 mM Gly-NaOH buffer with 600 mM NaCl | 10.5 | 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | n-Hexane | β | 100 | 118 | % | Direct | Continuous | 50 mM Gly-NaOH buffer with 600 mM NaCl | 10.5 | 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Chloroform | β | 100 | 81 | % | Direct | Continuous | 50 mM Gly-NaOH buffer with 600 mM NaCl | 10.5 | 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Ethyl Acetate | β | 100 | 33 | % | Direct | Continuous | 50 mM Gly-NaOH buffer with 600 mM NaCl | 10.5 | 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Acetonitrile | 50 % v/v | 100 | 0 | % | Direct | Continuous | 50 mM Gly-NaOH buffer with 600 mM NaCl | 10.5 | 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Methanol | 50 % v/v | 100 | 9 | % | Direct | Continuous | 50 mM Gly-NaOH buffer with 600 mM NaCl | 10.5 | 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 50 % v/v | 100 | 41 | % | Direct | Continuous | 50 mM Gly-NaOH buffer with 600 mM NaCl | 10.5 | 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 100 | 40 | % | Direct | Continuous | 50 mM Gly-NaOH buffer with 600 mM NaCl | 10.5 | 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | n-Decane | β | 100 | 91 | % | Direct | Continuous | 50 mM Gly-NaOH buffer without NaCl | 10.5 | 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | n-Hexane | β | 100 | 60 | % | Direct | Continuous | 50 mM Gly-NaOH buffer without NaCl | 10.5 | 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Chloroform | β | 100 | 79 | % | Direct | Continuous | 50 mM Gly-NaOH buffer without NaCl | 10.5 | 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Acetonitrile | 50 % v/v | 100 | 0 | % | Direct | Continuous | 50 mM Gly-NaOH buffer without NaCl | 10.5 | 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Methanol | 50 % v/v | 100 | 25 | % | Direct | Continuous | 50 mM Gly-NaOH buffer without NaCl | 10.5 | 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 50 % v/v | 100 | 13 | % | Direct | Continuous | 50 mM Gly-NaOH buffer without NaCl | 10.5 | 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 100 | 0 | % | Direct | Continuous | 50 mM Gly-NaOH buffer without NaCl | 10.5 | 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Classical aqueous control (in %) |
| Stability - Incubation | Activity after incubation (4 hours at 55Β°C), measured by absorance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 100 | 98 | % | Direct | Continuous | Incubation: 50 mM Gly-NaOH, Assay: 50 mM Gly-NaOH | Incubation: 10.5, Assay: 10.5 | Incubation: 55Β°C, Assay: 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (4 hours at 55Β°C), measured by absorance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in aqueous phase | n-Decane | 50 % v/v | 100 | 36 | % | Direct | Continuous | Incubation: 50 mM Gly-NaOH, Assay: 50 mM Gly-NaOH | Incubation: 10.5, Assay: 10.5 | Incubation: 55Β°C, Assay: 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (4 hours at 55Β°C), measured by absorance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in aqueous phase | n-Hexane | 50 % v/v | 100 | 105 | % | Direct | Continuous | Incubation: 50 mM Gly-NaOH, Assay: 50 mM Gly-NaOH | Incubation: 10.5, Assay: 10.5 | Incubation: 55Β°C, Assay: 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
| Stability - Incubation | Activity after incubation (4 hours at 55Β°C), measured by absorance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in aqueous phase | Chloroform | 50 % v/v | 100 | 105 | % | Direct | Continuous | Incubation: 50 mM Gly-NaOH, Assay: 50 mM Gly-NaOH | Incubation: 10.5, Assay: 10.5 | Incubation: 55Β°C, Assay: 60Β°C | 250 mM Isopropanol | Propanone | NADP+ | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.
Structure
π§¬
No structure available for this protein.