Cytochrome P450 CYP102A1 from Priestia megaterium
Enzyme Description
Sequence
TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPSTEQSAKKVR
Kersten S. Rabe et al. (2010)
β Peroxidase activity of bacterial cytochrome P450 enzymes: Modulation by fatty acids and organic solvents
Biotechnology Journal
Β· doi:10.1002/biot.201000028 β
Β· Activity - Classical
▼
Database ID
UniProt: P14779 β
Sequence Annotation
Inferred (only P450 domain, residues 2-472 from the UniProt sequence)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (4 measurements)
4 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity (in nmol substrate per nmol enzyme per second) measured by fluorescence spectrophotometry (resorufin fluorescence measurement) in the presence of organic solvent | Methanol | 10 % v/v | 0.0022 | 0.0021 | nmol substrate per nmol enzyme per second | Digital | Continuous | 50 mM potassium phosphate buffer | 7 | 25Β°C | 1 Β΅M Amplex red, 1 mM HβOβ (Hydrogen Peroxide) | H2O , Resorufin | β | β | Classical aqueous control (in nmol substrate per nmol enzyme per second)) | Here peroxidase activity measured, hence the EC number choice |
| Activity - Classical | Activity (in nmol substrate per nmol enzyme per second) measured by fluorescence spectrophotometry (resorufin fluorescence measurement) in the presence of organic solvent | Ethanol | 10 % v/v | 0.0022 | 0.0019 | nmol substrate per nmol enzyme per second | Digital | Continuous | 50 mM potassium phosphate buffer | 7 | 25Β°C | 1 Β΅M Amplex red, 1 mM HβOβ (Hydrogen Peroxide) | H2O , Resorufin | β | β | Classical aqueous control (in nmol substrate per nmol enzyme per second)) | Here peroxidase activity measured, hence the EC number choice |
| Activity - Classical | Activity (in nmol substrate per nmol enzyme per second) measured by fluorescence spectrophotometry (resorufin fluorescence measurement) in the presence of organic solvent | Isopropanol | 10 % v/v | 0.0022 | 0.0047 | nmol substrate per nmol enzyme per second | Digital | Continuous | 50 mM potassium phosphate buffer | 7 | 25Β°C | 1 Β΅M Amplex red, 1 mM HβOβ (Hydrogen Peroxide) | H2O , Resorufin | β | β | Classical aqueous control (in nmol substrate per nmol enzyme per second)) | Here peroxidase activity measured, hence the EC number choice |
| Activity - Classical | Activity (in nmol substrate per nmol enzyme per second) measured by fluorescence spectrophotometry (resorufin fluorescence measurement) in the presence of organic solvent | Acetonitrile | 10 % v/v | 0.0022 | 0.0039 | nmol substrate per nmol enzyme per second | Digital | Continuous | 50 mM potassium phosphate buffer | 7 | 25Β°C | 1 Β΅M Amplex red, 1 mM HβOβ (Hydrogen Peroxide) | H2O , Resorufin | β | β | Classical aqueous control (in nmol substrate per nmol enzyme per second)) | Here peroxidase activity measured, hence the EC number choice |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.