Cytochrome P450 CYP102A1 from Priestia megaterium

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 471 amino acids
TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPSTEQSAKKVR
Kersten S. Rabe et al. (2010) β€” Peroxidase activity of bacterial cytochrome P450 enzymes: Modulation by fatty acids and organic solvents
Biotechnology Journal  Β· doi:10.1002/biot.201000028 β†—  Β· Activity - Classical
4 measurements
Database ID
UniProt: P14779 β†—
Sequence Annotation
Inferred (only P450 domain, residues 2-472 from the UniProt sequence)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (4 measurements)

4 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity (in nmol substrate per nmol enzyme per second) measured by fluorescence spectrophotometry (resorufin fluorescence measurement) in the presence of organic solvent Methanol 10 % v/v 0.0022 0.0021 nmol substrate per nmol enzyme per second Digital Continuous 50 mM potassium phosphate buffer 7 25Β°C 1 Β΅M Amplex red, 1 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) H2O , Resorufin β€” β€” Classical aqueous control (in nmol substrate per nmol enzyme per second)) | Here peroxidase activity measured, hence the EC number choice
Activity - Classical Activity (in nmol substrate per nmol enzyme per second) measured by fluorescence spectrophotometry (resorufin fluorescence measurement) in the presence of organic solvent Ethanol 10 % v/v 0.0022 0.0019 nmol substrate per nmol enzyme per second Digital Continuous 50 mM potassium phosphate buffer 7 25Β°C 1 Β΅M Amplex red, 1 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) H2O , Resorufin β€” β€” Classical aqueous control (in nmol substrate per nmol enzyme per second)) | Here peroxidase activity measured, hence the EC number choice
Activity - Classical Activity (in nmol substrate per nmol enzyme per second) measured by fluorescence spectrophotometry (resorufin fluorescence measurement) in the presence of organic solvent Isopropanol 10 % v/v 0.0022 0.0047 nmol substrate per nmol enzyme per second Digital Continuous 50 mM potassium phosphate buffer 7 25Β°C 1 Β΅M Amplex red, 1 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) H2O , Resorufin β€” β€” Classical aqueous control (in nmol substrate per nmol enzyme per second)) | Here peroxidase activity measured, hence the EC number choice
Activity - Classical Activity (in nmol substrate per nmol enzyme per second) measured by fluorescence spectrophotometry (resorufin fluorescence measurement) in the presence of organic solvent Acetonitrile 10 % v/v 0.0022 0.0039 nmol substrate per nmol enzyme per second Digital Continuous 50 mM potassium phosphate buffer 7 25Β°C 1 Β΅M Amplex red, 1 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) H2O , Resorufin β€” β€” Classical aqueous control (in nmol substrate per nmol enzyme per second)) | Here peroxidase activity measured, hence the EC number choice

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*