Aldo-keto reductase from Thermotoga maritima

Enzyme Description

Species
Thermotoga maritima β†—
Extremophile
Yes "thermophilic" organism
EC Number
1.1.1.2 β†—

Sequence

Length: 333 amino acids
MGIPKRKLGERGPEVSAIGLGCMRMSFGQKKLPDRKEMIKLIRTAVELGINFFDTAEVYGPYTNEELVGEALEPFKGEVVIATKFGFELYEDGRPGWKGLNSNPEHIKKAVEGSLRRLRVEAIDILYQHRVDPNVPIEEVAGAVKELIEEGKVKHFGLCEASAETIRRAHKVCPVDVVQYEYSMWWRKPEEELLPTCEELGIGFVAYSPLGKGFLTGAIGENSKFDEEDSRSRIPRFQKENLRENLALVELRKTIAERKGATPSQIALAWLLAQKPWIVPIPGTTKLSHLLENIGGAFVELTPEELQEINDALSRIEIKGSRYPEDMEKMTYL
Simon Willies et al. (2010) β€” Thermophilic enzymes and their applications in biocatalysis: a robust aldo-keto reductase
Environmental Technology  Β· doi:10.1080/09593330.2010.490857 β†—  Β· Stability - Incubation
14 measurements ▼
Database ID
UniProt: Q9X0A1 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (14 measurements)

14 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 5 % v/v 100 84 % Digital Continuous 50 mM imidazole 6.5 50Β°C 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde 3-Cyclohexene-1-methanol 0.1 mM NADPH β€” Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 20 % v/v 100 64 % Digital Continuous 50 mM imidazole 6.5 50Β°C 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde 3-Cyclohexene-1-methanol 0.1 mM NADPH β€” Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 40 % v/v 100 8 % Digital Continuous 50 mM imidazole 6.5 50Β°C 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde 3-Cyclohexene-1-methanol 0.1 mM NADPH β€” Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 60 % v/v 100 0 % Digital Continuous 50 mM imidazole 6.5 50Β°C 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde 3-Cyclohexene-1-methanol 0.1 mM NADPH β€” Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 5 % v/v 100 84 % Digital Continuous 50 mM imidazole 6.5 50Β°C 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde 3-Cyclohexene-1-methanol 0.1 mM NADPH β€” Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 20 % v/v 100 28 % Digital Continuous 50 mM imidazole 6.5 50Β°C 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde 3-Cyclohexene-1-methanol 0.1 mM NADPH β€” Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 40 % v/v 100 0 % Digital Continuous 50 mM imidazole 6.5 50Β°C 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde 3-Cyclohexene-1-methanol 0.1 mM NADPH β€” Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent 1-Butanol 5 % v/v 100 66 % Digital Continuous 50 mM imidazole 6.5 50Β°C 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde 3-Cyclohexene-1-methanol 0.1 mM NADPH β€” Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent 1-Butanol 20 % v/v 100 30 % Digital Continuous 50 mM imidazole 6.5 50Β°C 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde 3-Cyclohexene-1-methanol 0.1 mM NADPH β€” Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent 1-Butanol 40 % v/v 100 0 % Digital Continuous 50 mM imidazole 6.5 50Β°C 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde 3-Cyclohexene-1-methanol 0.1 mM NADPH β€” Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5 % v/v 100 78 % Digital Continuous 50 mM imidazole 6.5 50Β°C 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde 3-Cyclohexene-1-methanol 0.1 mM NADPH β€” Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20 % v/v 100 71 % Digital Continuous 50 mM imidazole 6.5 50Β°C 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde 3-Cyclohexene-1-methanol 0.1 mM NADPH β€” Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 40 % v/v 100 29 % Digital Continuous 50 mM imidazole 6.5 50Β°C 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde 3-Cyclohexene-1-methanol 0.1 mM NADPH β€” Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 60 % v/v 100 0 % Digital Continuous 50 mM imidazole 6.5 50Β°C 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde 3-Cyclohexene-1-methanol 0.1 mM NADPH β€” Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*