Aldo-keto reductase from Thermotoga maritima
Enzyme Description
Sequence
MGIPKRKLGERGPEVSAIGLGCMRMSFGQKKLPDRKEMIKLIRTAVELGINFFDTAEVYGPYTNEELVGEALEPFKGEVVIATKFGFELYEDGRPGWKGLNSNPEHIKKAVEGSLRRLRVEAIDILYQHRVDPNVPIEEVAGAVKELIEEGKVKHFGLCEASAETIRRAHKVCPVDVVQYEYSMWWRKPEEELLPTCEELGIGFVAYSPLGKGFLTGAIGENSKFDEEDSRSRIPRFQKENLRENLALVELRKTIAERKGATPSQIALAWLLAQKPWIVPIPGTTKLSHLLENIGGAFVELTPEELQEINDALSRIEIKGSRYPEDMEKMTYL
Simon Willies et al. (2010)
β Thermophilic enzymes and their applications in biocatalysis: a robust aldo-keto reductase
Environmental Technology
Β· doi:10.1080/09593330.2010.490857 β
Β· Stability - Incubation
▼
Database ID
UniProt: Q9X0A1 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21
Experimental Data (14 measurements)
14 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Isopropanol | 5 % v/v | 100 | 84 | % | Digital | Continuous | 50 mM imidazole | 6.5 | 50Β°C | 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde | 3-Cyclohexene-1-methanol | 0.1 mM NADPH | β | Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent |
| Stability - Incubation | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Isopropanol | 20 % v/v | 100 | 64 | % | Digital | Continuous | 50 mM imidazole | 6.5 | 50Β°C | 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde | 3-Cyclohexene-1-methanol | 0.1 mM NADPH | β | Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent |
| Stability - Incubation | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Isopropanol | 40 % v/v | 100 | 8 | % | Digital | Continuous | 50 mM imidazole | 6.5 | 50Β°C | 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde | 3-Cyclohexene-1-methanol | 0.1 mM NADPH | β | Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent |
| Stability - Incubation | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Isopropanol | 60 % v/v | 100 | 0 | % | Digital | Continuous | 50 mM imidazole | 6.5 | 50Β°C | 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde | 3-Cyclohexene-1-methanol | 0.1 mM NADPH | β | Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent |
| Stability - Incubation | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Acetonitrile | 5 % v/v | 100 | 84 | % | Digital | Continuous | 50 mM imidazole | 6.5 | 50Β°C | 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde | 3-Cyclohexene-1-methanol | 0.1 mM NADPH | β | Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent |
| Stability - Incubation | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Acetonitrile | 20 % v/v | 100 | 28 | % | Digital | Continuous | 50 mM imidazole | 6.5 | 50Β°C | 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde | 3-Cyclohexene-1-methanol | 0.1 mM NADPH | β | Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent |
| Stability - Incubation | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Acetonitrile | 40 % v/v | 100 | 0 | % | Digital | Continuous | 50 mM imidazole | 6.5 | 50Β°C | 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde | 3-Cyclohexene-1-methanol | 0.1 mM NADPH | β | Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent |
| Stability - Incubation | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | 1-Butanol | 5 % v/v | 100 | 66 | % | Digital | Continuous | 50 mM imidazole | 6.5 | 50Β°C | 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde | 3-Cyclohexene-1-methanol | 0.1 mM NADPH | β | Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent |
| Stability - Incubation | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | 1-Butanol | 20 % v/v | 100 | 30 | % | Digital | Continuous | 50 mM imidazole | 6.5 | 50Β°C | 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde | 3-Cyclohexene-1-methanol | 0.1 mM NADPH | β | Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent |
| Stability - Incubation | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | 1-Butanol | 40 % v/v | 100 | 0 | % | Digital | Continuous | 50 mM imidazole | 6.5 | 50Β°C | 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde | 3-Cyclohexene-1-methanol | 0.1 mM NADPH | β | Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent |
| Stability - Incubation | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 5 % v/v | 100 | 78 | % | Digital | Continuous | 50 mM imidazole | 6.5 | 50Β°C | 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde | 3-Cyclohexene-1-methanol | 0.1 mM NADPH | β | Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent |
| Stability - Incubation | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 100 | 71 | % | Digital | Continuous | 50 mM imidazole | 6.5 | 50Β°C | 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde | 3-Cyclohexene-1-methanol | 0.1 mM NADPH | β | Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent |
| Stability - Incubation | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 40 % v/v | 100 | 29 | % | Digital | Continuous | 50 mM imidazole | 6.5 | 50Β°C | 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde | 3-Cyclohexene-1-methanol | 0.1 mM NADPH | β | Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent |
| Stability - Incubation | Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 60 % v/v | 100 | 0 | % | Digital | Continuous | 50 mM imidazole | 6.5 | 50Β°C | 0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde | 3-Cyclohexene-1-methanol | 0.1 mM NADPH | β | Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity | Uncertainty about whether control was really measured in the presence of organic solvent |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.