Esterase from Geobacillus sp. GSM-2009b

Enzyme Description

Extremophile
Yes thermophilic organism
EC Number

Sequence

Length: 247 amino acids
MMKVVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPPEELVHTGPDDWWQDVMNGYQFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIQGIVTMCAPMYIKSEETMYEGVLEYAREYKKREGKSEEQIEQEMERFKQTPMKTLKALQELIADVRAHLDLVYAPTFVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYAFLESLDW
Hasan Cihad Tekedar et al. (2010) β€” Molecular cloning, over expression and characterization of thermoalkalophilic esterases isolated from Geobacillus sp.
Extremophiles  Β· doi:10.1007/s00792-010-0344-1 β†—  Β· Activity - Classical
6 measurements
Database ID
UniProt: E4WLM2 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (6 measurements)

6 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent Isopropanol 1 % v/v 100 72 % Direct Continuous 100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100 7.2 55Β°C 0.5 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent Ethanol 1 % v/v 100 95 % Direct Continuous 100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100 7.2 55Β°C 0.5 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent Methanol 1 % v/v 100 93 % Direct Continuous 100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100 7.2 55Β°C 0.5 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent Acetone 1 % v/v 100 79 % Direct Continuous 100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100 7.2 55Β°C 0.5 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent n-Hexane 1 % v/v 100 50 % Direct Continuous 100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100 7.2 55Β°C 0.5 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent Chloroform 1 % v/v 100 10 % Direct Continuous 100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100 7.2 55Β°C 0.5 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*