Haloalkane dehalogenase DbjA from Bradyrhizobium japonicum

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 310 amino acids
MSKPIEIEIRRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILPLVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLVAQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHHTEVAEEQDHAEAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTPFPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGEPGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAGIEAVRPQLAA
Veronika Stepankova et al. (2013) β€” Organic co-solvents affect activity, stability and enantioselectivity of haloalkane dehalogenases
Biotechnology Journal  Β· doi:10.1002/biot.201200378 β†—  Β· Activity - Classical Stability - C50 Stability - Tm Selectivity - Enantioselectivity
152 measurements
Database ID
UniProt: P59337 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (152 measurements)

152 measurements β€” page 6 of 8
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Ethylene Glycol 75 % v/v 100.0 43.0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent PEG-1000 75 % v/v 100.0 111.0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent PEG-10000 75 % v/v 100.0 0.0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Dimethylformamide (DMF) 75 % v/v 100.0 0.0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 75 % v/v 100.0 0.0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Methanol 75 % v/v 100.0 0.0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent 1,4-Dioxane 75 % v/v 100.0 0.0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Acetonitrile 75 % v/v 100.0 0.0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Ethanol 75 % v/v 100.0 0.0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Acetone 75 % v/v 100.0 0.0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Isopropanol 75 % v/v 100.0 0.0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Tetrahydrofuran (THF) 75 % v/v 100.0 0.0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Selectivity - Enantioselectivity E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent Ethylene Glycol 50 % v/v 1.0 3.0 relative units, (kcat/Km)R/(kcat/Km Direct Continuous Tris-sulfate 50 mM 8.2 20 0.5 mM 2-Bromobutane 2-Butanol , Bromide ion β€” β€” Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Selectivity - Enantioselectivity E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent 1,4-Dioxane 20 % v/v 1.0 1.0 relative units, (kcat/Km)R/(kcat/Km Direct Continuous Tris-sulfate 50 mM 8.2 20 0.5 mM 2-Bromobutane 2-Butanol , Bromide ion β€” β€” Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Selectivity - Enantioselectivity E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent Ethylene Glycol 50 % v/v 132.0 >200.0 relative units, (kcat/Km)R/(kcat/Km Direct Continuous Tris-sulfate 50 mM 8.2 20 0.5 mM 2-Bromopentane 2-Pentanol , Bromide ion β€” β€” Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Selectivity - Enantioselectivity E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent Formamide 5 % v/v 132.0 93.0 relative units, (kcat/Km)R/(kcat/Km Direct Continuous Tris-sulfate 50 mM 8.2 20 0.5 mM 2-Bromopentane 2-Pentanol , Bromide ion β€” β€” Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Selectivity - Enantioselectivity E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent Dimethylformamide (DMF) 10 % v/v 132.0 133.0 relative units, (kcat/Km)R/(kcat/Km Direct Continuous Tris-sulfate 50 mM 8.2 20 0.5 mM 2-Bromopentane 2-Pentanol , Bromide ion β€” β€” Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Selectivity - Enantioselectivity E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20 % v/v 132.0 143.0 relative units, (kcat/Km)R/(kcat/Km Direct Continuous Tris-sulfate 50 mM 8.2 20 0.5 mM 2-Bromopentane 2-Pentanol , Bromide ion β€” β€” Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Selectivity - Enantioselectivity E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent Methanol 20 % v/v 132.0 124.0 relative units, (kcat/Km)R/(kcat/Km Direct Continuous Tris-sulfate 50 mM 8.2 20 0.5 mM 2-Bromopentane 2-Pentanol , Bromide ion β€” β€” Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Selectivity - Enantioselectivity E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent 1,4-Dioxane 10 % v/v 132.0 194.0 relative units, (kcat/Km)R/(kcat/Km Direct Continuous Tris-sulfate 50 mM 8.2 20 0.5 mM 2-Bromopentane 2-Pentanol , Bromide ion β€” β€” Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
1 … 5 6 7 8

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” C50

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*