Lipase LipC12 from a wastewater treatment plant lagoon metagenomic library

Enzyme Description

Species
Na (wastewater treatment plant lagoon metagenomic library)
Extremophile
No
EC Number

Sequence

Length: 293 amino acids
MSASSLKFPIVLVHGLLGFDKIGGIYPYFYGIKEALEKAGAKVYIATLSALNSNELRGEQLLEFVRKVQAETGAAKVNLIGHSQGPLACRYVAATHPELIASVTSVNGVNHGSEVADLVRLALTPGRLPESIANAAMSAFGQLLSALAGSPRLPQSGIEALEALTSEGVAAFNNKYPQGLPAEWGGEGKELVNGVYYYSWSGVIDYNPLHQGANNLDPLHVAMLAFSILFTNERFQNDGLVGRYSSHLGKVIGSDYSMDHVDAINQLAGVVANNTDPVQLFVEHVARLKSKGL
Arnaldo Glogauer et al. (2011) β€” Identification and characterization of a new true lipase isolated through metagenomic approach
Microbial Cell Factories  Β· doi:10.1186/1475-2859-10-54 β†—  Β· Stability - Incubation
22 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (22 measurements)

22 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 15 % v/v 100.0 587.6 % Direct Continuous Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol Incubation: 8, Assay: 7.5 Incubation: 4Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay
Stability - Incubation Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 30 % v/v 100.0 1561.1 % Direct Continuous Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol Incubation: 8, Assay: 7.5 Incubation: 4Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*