Haloalkane dehalogenase DhaA from Rhodococcus rhodochrous

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 293 amino acids
MSEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL
Veronika Stepankova et al. (2013) β€” Organic co-solvents affect activity, stability and enantioselectivity of haloalkane dehalogenases
Biotechnology Journal  Β· doi:10.1002/biot.201200378 β†—  Β· Activity - Classical Stability - C50 Stability - Tm
136 measurements
Database ID
UniProt: P0A3G2 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (136 measurements)

136 measurements β€” page 4 of 7
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent PEG-10000 40 % v/v 100 66 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Dimethylformamide (DMF) 40 % v/v 100 0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 40 % v/v 100 71 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Methanol 40 % v/v 100 0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent 1,4-Dioxane 40 % v/v 100 0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Acetonitrile 40 % v/v 100 0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Ethanol 40 % v/v 100 0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Acetone 40 % v/v 100 0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Isopropanol 40 % v/v 100 0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Tetrahydrofuran (THF) 40 % v/v 100 0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Glycerol 50 % v/v 100 96 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Formamide 50 % v/v 100 0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Ethylene Glycol 50 % v/v 100 98 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent PEG-1000 50 % v/v 100 119 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent PEG-10000 50 % v/v 100 0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Dimethylformamide (DMF) 50 % v/v 100 0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50 % v/v 100 45 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Methanol 50 % v/v 100 0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent 1,4-Dioxane 50 % v/v 100 0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Acetonitrile 50 % v/v 100 0 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
1 … 3 4 5 … 7

Visualization : Activity β€” Classical

Veronika Stepankova et al. (2013)

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

Veronika Stepankova et al. (2013)

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” C50

Veronika Stepankova et al. (2013)

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Tana Koudelakova et al. (2013) β€” Engineering Enzyme Stability and Resistance to an Organic Cosolvent by Modification of Residues in the Access Tunnel
Angewandte Chemie International Edition  Β· doi:10.1002/anie.201206708 β†—  Β· Activity - Classical Activity - Michaelis-Menten Stability - C50 Stability - Inactivation Rate Constant Stability - Tm
66 measurements

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*