Ene-reductase Chr-OYE1 from Chryseobacterium sp. CA49

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 353 amino acids
MSTESLFTPFKYKNLELKNRIVMAPMTRAQSDNGVPTQQIADYYARRAAAEVGLILSEGTVINRPASKNMQNIPDFYGTEALNGWKNVIDAVHHNGGKMGPQIWHVGDTRSTPDYPLEDMEKASTMTLEDIQDTIAQFAASAKSAKDLGFDVLEIHGAHGYLIDQFFWEGTNTRTDEYGGKTIKERSRFAVDVVKAIRAAVGEDFTIIIRLSQWKQQDYSVKLAHTPEEMEEWLLPLKDAGVDIFHCSQRRFWEPEFEGSDLNFAGWAKKITGQPTITVGSVGLEGDFMAAFGGQGTEKADLTELTKRLERGDFDLVAVGRALLQDPEWAKKVKEQNTEALLDFSAESLGVLY
Frieda A. Sorgenfrei et al. (2024) β€” Solvent concentration at 50% protein unfolding may reform enzyme stability ranking and process window identification
Nature Communications  Β· doi:10.1038/s41467-024-49774-0 β†—  Β· Activity - Classical Stability - C50 Stability - Tm
159 measurements
Database ID
Sequence Annotation
Explicit - Provided UniProt Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (159 measurements)

159 measurements β€” page 8 of 8
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Ethanol 30 % v/v 47.0 30.0 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Methanol 5 % v/v 47.0 46.0 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Methanol 10 % v/v 47.0 40.33 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Methanol 15 % v/v 47.0 36.0 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Methanol 20 % v/v 47.0 37.0 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Methanol 25 % v/v 47.0 35.33 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Methanol 30 % v/v 47.0 31.33 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Isopropanol 5 % v/v 47.0 41.67 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Isopropanol 10 % v/v 47.0 36.67 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Isopropanol 15 % v/v 47.0 35.0 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Isopropanol 20 % v/v 47.0 33.0 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Isopropanol 25 % v/v 47.0 30.0 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Isopropanol 30 % v/v 47.0 29.0 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent 1-Propanol 5 % v/v 47.0 39.33 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent 1-Propanol 10 % v/v 47.0 32.33 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent 1-Propanol 15 % v/v 47.0 29.67 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent 1-Propanol 20 % v/v 47.0 28.33 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent 1-Propanol 25 % v/v 47.0 27.0 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent 1-Propanol 30 % v/v 47.0 27.0 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
1 … 5 6 7 8
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” C50

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*