Esterase (gene EstA) with mesophilic expression from Sulfolobus islandicus

Enzyme Description

Extremophile
Yes thermophilic organism
EC Number

Sequence

Length: 305 amino acids
MPLDPRIKELLESGFIVPIGKASVDEVRKIFRQLASAAPKVEVGKVEDIKIPGSEANINARVYLPKANGPYGVLIYLHGGGFVIGDVESYDPLCRAITNACNCVVVSVDYRLAPEYKFPSAVIDSFDATNWVYNNLDKFDGKMGVAIAGDSAGGNLAAVVALLSKGKLNLKYQILIYPAVGFDSVSRSMIEYSDGFFLTREHIEWFGSQYLRSPADLLDFRFSPILAQDLSGLPPALIITAEYDPLRDQGEAYANRLLQAGVPVTSVRFNNVIHGFLSFFPLIEQGRDAISLIGSVLRRTFYDKS
Yuxia Mei et al. (2011) β€” Exceptional thermal stability and organic solvent tolerance of an esterase expressed from a thermophilic host
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-011-3504-z β†—  Β· Stability - Incubation
22 measurements
Database ID
UniProt: F0NDQ1 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (22 measurements)

22 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Ethanol 30 % v/v 100.0 41.4 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Methanol 60 % v/v 100.0 23.1 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*