Haloalkane dehalogenase linB from Sphingobium japonicum

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 296 amino acids
MSLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Veronika Stepankova et al. (2013) β€” Organic co-solvents affect activity, stability and enantioselectivity of haloalkane dehalogenases
Biotechnology Journal  Β· doi:10.1002/biot.201200378 β†—  Β· Activity - Classical Stability - C50 Stability - Tm
136 measurements
Database ID
UniProt: D4Z2G1 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (136 measurements)

136 measurements β€” page 7 of 7
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - C50 Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent 1,4-Dioxane β€” β€” 1 % (v/v) Direct Continuous glycine 100 mM 8.6 37Β°C 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Not applicable control (in % (v/v))
Stability - C50 Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Acetone β€” β€” 16 % (v/v) Direct Continuous glycine 100 mM 8.6 37Β°C 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Not applicable control (in % (v/v))
Stability - C50 Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Isopropanol β€” β€” 12 % (v/v) Direct Continuous glycine 100 mM 8.6 37Β°C 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Not applicable control (in % (v/v))
Stability - C50 Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Tetrahydrofuran (THF) β€” β€” 6 % (v/v) Direct Continuous glycine 100 mM 8.6 37Β°C 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Not applicable control (in % (v/v))
Stability - Tm Tm measured by circular dichroism in the presence of organic solvent Ethylene Glycol 20 % v/v 49 49 Β°C Direct Continuous 50 mM phosphate buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C), measured by circular dichroism
Stability - Tm Tm measured by DSC in the presence of organic solvent Dimethylformamide (DMF) 20 % v/v 49 38 Β°C Direct Continuous 50 mM phosphate buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C) measured by DSC
Stability - Tm Tm measured by DSC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20 % v/v 49 49 Β°C Direct Continuous 50 mM phosphate buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C) measured by DSC
Stability - Tm Tm measured by circular dichroism in the presence of organic solvent Methanol 20 % v/v 49 43 Β°C Direct Continuous 50 mM phosphate buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C), measured by circular dichroism
Stability - Tm Tm measured by circular dichroism in the presence of organic solvent 1,4-Dioxane 20 % v/v 49 36 Β°C Direct Continuous 50 mM phosphate buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C), measured by circular dichroism
Stability - Tm Tm measured by circular dichroism in the presence of organic solvent Acetonitrile 10 % v/v 49 39 Β°C Direct Continuous 50 mM phosphate buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C), measured by circular dichroism
Stability - Tm Tm measured by circular dichroism in the presence of organic solvent Acetonitrile 20 % v/v 49 <10 Β°C Direct Continuous 50 mM phosphate buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C), measured by circular dichroism
Stability - Tm Tm measured by circular dichroism in the presence of organic solvent Ethanol 20 % v/v 49 39 Β°C Direct Continuous 50 mM phosphate buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C), measured by circular dichroism
Stability - Tm Tm measured by circular dichroism in the presence of organic solvent Acetone 20 % v/v 49 36 Β°C Direct Continuous 50 mM phosphate buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C), measured by circular dichroism
Stability - Tm Tm measured by circular dichroism in the presence of organic solvent Isopropanol 20 % v/v 49 37 Β°C Direct Continuous 50 mM phosphate buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C), measured by circular dichroism
Stability - Tm Tm measured by circular dichroism in the presence of organic solvent Tetrahydrofuran (THF) 10 % v/v 49 34 Β°C Direct Continuous 50 mM phosphate buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C), measured by circular dichroism
Stability - Tm Tm measured by circular dichroism in the presence of organic solvent Tetrahydrofuran (THF) 20 % v/v 49 <10 Β°C Direct Continuous 50 mM phosphate buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C), measured by circular dichroism
1 … 4 5 6 7
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” C50

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*