Esterase (gene EstC) from Streptomyces coelicolor A3(2)
Enzyme Description
Extremophile
No
but "cold-active" enzyme
EC Number
Sequence
MSRNAAFSPPPSARAYRLRTARGEFAVVDSPAAAGVAPRGVVMMLPGFTGSKEDFTLLHRPLGARGYRTVAVDGRGQYESDGPEHDESAYARPELARDVLAQAAALGTRVHLVGHSLGGQIARAAVLLDPAPFLSLTLMSSGPARISESQRQRVKLLRDALDTMTMAEVWEVMQAMGPPEEAGAPAPAHGPEDRVRLRDRWLGTRPAQLLATGGQLCTEPDRVAELAAVPLPFHVLSGTYDDTWPVPLLDEMALRLDARRTVVAGAEHSPNTDQPLPTARALADFWDDHPVPPRPYVR
Guillaume Brault et al. (2012)
β Isolation and Characterization of EstC, a New Cold-Active Esterase from Streptomyces coelicolor A3(2)
PLoS ONE
Β· doi:10.1371/journal.pone.0032041 β
Β· Stability - Incubation
▼
Database ID
UniProt: Q9FBJ3 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (16 measurements)
16 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetone | 10 % v/v | 100 | 108 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 0.1% Triton X-100 (v/v) | Incubation: 8.5, Assay: 8.5 | Incubation: 25Β°C, Assay: 25Β°C | 0.05 mM p-Nitrophenyl valerate | p-Nitrophenol , Pentanoic Acid | β | β | Water-incubated control (in %), activity in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetone | 30 % v/v | 100 | 2 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 0.1% Triton X-100 (v/v) | Incubation: 8.5, Assay: 8.5 | Incubation: 25Β°C, Assay: 25Β°C | 0.05 mM p-Nitrophenyl valerate | p-Nitrophenol , Pentanoic Acid | β | β | Water-incubated control (in %), activity in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 10 % v/v | 100 | 96 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 0.1% Triton X-100 (v/v) | Incubation: 8.5, Assay: 8.5 | Incubation: 25Β°C, Assay: 25Β°C | 0.05 mM p-Nitrophenyl valerate | p-Nitrophenol , Pentanoic Acid | β | β | Water-incubated control (in %), activity in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 30 % v/v | 100 | 59 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 0.1% Triton X-100 (v/v) | Incubation: 8.5, Assay: 8.5 | Incubation: 25Β°C, Assay: 25Β°C | 0.05 mM p-Nitrophenyl valerate | p-Nitrophenol , Pentanoic Acid | β | β | Water-incubated control (in %), activity in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100 | 105 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 0.1% Triton X-100 (v/v) | Incubation: 8.5, Assay: 8.5 | Incubation: 25Β°C, Assay: 25Β°C | 0.05 mM p-Nitrophenyl valerate | p-Nitrophenol , Pentanoic Acid | β | β | Water-incubated control (in %), activity in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100 | 104 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 0.1% Triton X-100 (v/v) | Incubation: 8.5, Assay: 8.5 | Incubation: 25Β°C, Assay: 25Β°C | 0.05 mM p-Nitrophenyl valerate | p-Nitrophenol , Pentanoic Acid | β | β | Water-incubated control (in %), activity in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethylformamide (DMF) | 10 % v/v | 100 | 110 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 0.1% Triton X-100 (v/v) | Incubation: 8.5, Assay: 8.5 | Incubation: 25Β°C, Assay: 25Β°C | 0.05 mM p-Nitrophenyl valerate | p-Nitrophenol , Pentanoic Acid | β | β | Water-incubated control (in %), activity in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethylformamide (DMF) | 30 % v/v | 100 | 56 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 0.1% Triton X-100 (v/v) | Incubation: 8.5, Assay: 8.5 | Incubation: 25Β°C, Assay: 25Β°C | 0.05 mM p-Nitrophenyl valerate | p-Nitrophenol , Pentanoic Acid | β | β | Water-incubated control (in %), activity in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 10 % v/v | 100 | 110 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 0.1% Triton X-100 (v/v) | Incubation: 8.5, Assay: 8.5 | Incubation: 25Β°C, Assay: 25Β°C | 0.05 mM p-Nitrophenyl valerate | p-Nitrophenol , Pentanoic Acid | β | β | Water-incubated control (in %), activity in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 30 % v/v | 100 | 1 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 0.1% Triton X-100 (v/v) | Incubation: 8.5, Assay: 8.5 | Incubation: 25Β°C, Assay: 25Β°C | 0.05 mM p-Nitrophenyl valerate | p-Nitrophenol , Pentanoic Acid | β | β | Water-incubated control (in %), activity in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 10 % v/v | 100 | 107 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 0.1% Triton X-100 (v/v) | Incubation: 8.5, Assay: 8.5 | Incubation: 25Β°C, Assay: 25Β°C | 0.05 mM p-Nitrophenyl valerate | p-Nitrophenol , Pentanoic Acid | β | β | Water-incubated control (in %), activity in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 30 % v/v | 100 | 75 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 0.1% Triton X-100 (v/v) | Incubation: 8.5, Assay: 8.5 | Incubation: 25Β°C, Assay: 25Β°C | 0.05 mM p-Nitrophenyl valerate | p-Nitrophenol , Pentanoic Acid | β | β | Water-incubated control (in %), activity in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Propanol | 10 % v/v | 100 | 90 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 0.1% Triton X-100 (v/v) | Incubation: 8.5, Assay: 8.5 | Incubation: 25Β°C, Assay: 25Β°C | 0.05 mM p-Nitrophenyl valerate | p-Nitrophenol , Pentanoic Acid | β | β | Water-incubated control (in %), activity in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Propanol | 30 % v/v | 100 | 16 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 0.1% Triton X-100 (v/v) | Incubation: 8.5, Assay: 8.5 | Incubation: 25Β°C, Assay: 25Β°C | 0.05 mM p-Nitrophenyl valerate | p-Nitrophenol , Pentanoic Acid | β | β | Water-incubated control (in %), activity in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Tetrahydrofuran (THF) | 10 % v/v | 100 | 25 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 0.1% Triton X-100 (v/v) | Incubation: 8.5, Assay: 8.5 | Incubation: 25Β°C, Assay: 25Β°C | 0.05 mM p-Nitrophenyl valerate | p-Nitrophenol , Pentanoic Acid | β | β | Water-incubated control (in %), activity in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Tetrahydrofuran (THF) | 30 % v/v | 100 | 4 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 0.1% Triton X-100 (v/v) | Incubation: 8.5, Assay: 8.5 | Incubation: 25Β°C, Assay: 25Β°C | 0.05 mM p-Nitrophenyl valerate | p-Nitrophenol , Pentanoic Acid | β | β | Water-incubated control (in %), activity in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.