Lipase (gene Lpc53E1) from a marine sponge Haliclona simulans metagenomic library
Enzyme Description
Species
Na (marine sponge Haliclona simulans metagenomic library)
Extremophile
No
but "halo-tolerant" enzyme
EC Number
Sequence
MKSRLNDILEAGIASGAAPGAVAIVVNADGVLWEGAAGERAVGTGRSMTTDTVGAIFSMTKAITGAAAMQLVEQNRLDLDAPAGEIIPWLNEVQVLDGFDDSGEPVLRAPNSPVTLRNLLTHTSGFTYEFWNANEARWKEKTGALSLFTLENAALQTPLAFDPGTQWEYGIGIDWVGKMVEAVSGMTLGEYFAEYLTGPLGMTDTAFTHSASMLERASAVHARLPDGTFQTIDLPQPENQEFEMGGGGLQGTMHDYGKFIRMILNDGELNGVRVLRSETVATMCENHIGDLRVQKLVTVAPTITNDAEFFPGRPKSWGLTFQINERAEDTGRPAGTLMWAGVLNSFFWIDRTNGVGGAYLSQMLPFADARSLGLFYDIERAVYQSLA
Joseph Selvin et al. (2012)
β Isolation identification and biochemical characterization of a novel halo-tolerant lipase from the metagenome of the marine sponge Haliclona simulans
Microbial Cell Factories
Β· doi:10.1186/1475-2859-11-72 β
Β· Stability - Incubation
▼
Database ID
UniParc: UPI000266165D β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli DH5alpha
Experimental Data (18 measurements)
18 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 20 % v/v | 100.0 | 220.5 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 20 % v/v | 100.0 | 271.2 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Glycerol | 20 % v/v | 100.0 | 214.3 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 100.0 | 220.5 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 20 % v/v | 100.0 | 208.2 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Butanol | 20 % v/v | 100.0 | 473.4 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 20 % v/v | 100.0 | 176.4 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 20 % v/v | 100.0 | 195.4 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetone | 20 % v/v | 100.0 | 157.4 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 10 % v/v | 100.0 | 126.1 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 10 % v/v | 100.0 | 155.1 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Glycerol | 10 % v/v | 100.0 | 270.3 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100.0 | 126.1 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 10 % v/v | 100.0 | 119.0 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Butanol | 10 % v/v | 100.0 | 122.3 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 10 % v/v | 100.0 | 101.0 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 10 % v/v | 100.0 | 111.4 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetone | 10 % v/v | 100.0 | 90.1 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile | Incubation: ?, Assay: 8.2 | Incubation: 4Β°C, Assay: 40Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.