Short-chain NAD(H)-dependent dehydrogenase/reductase Sulfolobus acidocaldarius DSM 639
Enzyme Description
Extremophile
Yes
"thermoacidophilic" organism
EC Number
Sequence
MSYQSLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELLEDRLNQIVQELRGMGKEVLGVKADVSKKKDVEEFVRRTFETYSRIDVLCNNAGIMDGVTPVAEVSDELWERVLAVNLYSAFYSSRAVIPIMLKQGKGVIVNTASIAGIRGGFAGAPYTVAKHGLIGLTRSIAAHYGDQGIRAVAVLPGTVKTNIGLGSSKPSELGMRTLTKLMSLSSRLAEPEDIANVIVFLASDEASFVNGDAVVVDGGLTVL
Angela Pennacchio et al. (2012)
β Biochemical and structural characterization of recombinant short-chain NAD(H)-dependent dehydrogenase/reductase from Sulfolobus acidocaldarius highly enantioselective on diaryl diketone benzil
Applied Microbiology and Biotechnology
Β· doi:10.1007/s00253-012-4273-z β
Β· Stability - Incubation
▼
Database ID
UniProt: Q4J9F2 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (8 measurements)
8 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) | Dimethyl Sulfoxide (DMSO) | 18 % v/v | 122 | 142 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 50Β°C, Assay: 50Β°C | 18 mM Cycloheptanol | Cycloheptanone | 3 mM NAD+ | β | Water-incubated control (in %) | 100% is the initial activity measured with the organic solvent, and 122/107 the change in activity after incubating in aqueous phase for the same duration |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) | Dimethyl Sulfoxide (DMSO) | 18 % v/v | 107 | 105 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 50Β°C, Assay: 50Β°C | 18 mM Cycloheptanol | Cycloheptanone | 3 mM NAD+ | β | Water-incubated control (in %) | 100% is the initial activity measured with the organic solvent, and 122/107 the change in activity after incubating in aqueous phase for the same duration |
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) | Acetonitrile | 18 % v/v | 122 | 84 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 50Β°C, Assay: 50Β°C | 18 mM Cycloheptanol | Cycloheptanone | 3 mM NAD+ | β | Water-incubated control (in %) | 100% is the initial activity measured with the organic solvent, and 122/107 the change in activity after incubating in aqueous phase for the same duration |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) | Acetonitrile | 18 % v/v | 107 | 72 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 50Β°C, Assay: 50Β°C | 18 mM Cycloheptanol | Cycloheptanone | 3 mM NAD+ | β | Water-incubated control (in %) | 100% is the initial activity measured with the organic solvent, and 122/107 the change in activity after incubating in aqueous phase for the same duration |
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) | 1,4-Dioxane | 18 % v/v | 122 | 135 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 50Β°C, Assay: 50Β°C | 18 mM Cycloheptanol | Cycloheptanone | 3 mM NAD+ | β | Water-incubated control (in %) | 100% is the initial activity measured with the organic solvent, and 122/107 the change in activity after incubating in aqueous phase for the same duration |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) | 1,4-Dioxane | 18 % v/v | 107 | 97 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 50Β°C, Assay: 50Β°C | 18 mM Cycloheptanol | Cycloheptanone | 3 mM NAD+ | β | Water-incubated control (in %) | 100% is the initial activity measured with the organic solvent, and 122/107 the change in activity after incubating in aqueous phase for the same duration |
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) | Ethyl Acetate | 18 % v/v | 122 | 95 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 50Β°C, Assay: 50Β°C | 18 mM Cycloheptanol | Cycloheptanone | 3 mM NAD+ | β | Water-incubated control (in %) | 100% is the initial activity measured with the organic solvent, and 122/107 the change in activity after incubating in aqueous phase for the same duration |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) | Ethyl Acetate | 18 % v/v | 107 | 96 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 50Β°C, Assay: 50Β°C | 18 mM Cycloheptanol | Cycloheptanone | 3 mM NAD+ | β | Water-incubated control (in %) | 100% is the initial activity measured with the organic solvent, and 122/107 the change in activity after incubating in aqueous phase for the same duration |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.