Esterase from Acinetobacter venetianus V28

Enzyme Description

Extremophile
No but "cold-adapted" enzyme
EC Number

Sequence

Length: 338 amino acids
MMMNTLLPILFRKTFTAFLLSCSLGAMAIQTTQAAEIEMSFQNLLQQERAWAGLQTKTLKVGDITWSYSDGGQAGKPIVILIHGLAGSRDNWNRVAHALTANYHVIIPDLPASGETKVPKEFDYSVPNVTEKLRRFIEAANLTGPAHIAGHSLGGSIAMLYAGQYPFETKSLFLIDAAGVYKSATTPYLKDPAQVKNMIVSKKGDFNYLMQQAMYSPPFIPKEIAQAQEKMMIGQVEETQKMVDQIIALNKLFTPDSFALLAKSIDAPTLILWGKQDKIINVEVAPELKSLLKNAQTPVILDNVGHMPILEADQLVVQQYLPFLSKIQAQKPATAPSP
Young-Ok Kim et al. (2012) β€” Gene Cloning and Characterization of a Cold-Adapted Esterase from Acinetobacter venetianus V28
Journal of Microbiology and Biotechnology  Β· doi:10.4014/jmb.1201.01045 β†—  Β· Activity + Stability - Incubation
14 measurements
Database ID
UniProt: J7EYB1 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (14 measurements)

14 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Incubation Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 15 % v/v 100 101 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 15 % v/v 100 102 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 15 % v/v 100 103 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 15 % v/v 100 102 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 15 % v/v 100 102 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent PEG-8000 15 % v/v 100 101 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 15 % v/v 100 101 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 30 % v/v 100 101 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 30 % v/v 100 102 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 30 % v/v 100 100 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 30 % v/v 100 101 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 30 % v/v 100 99 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent PEG-8000 30 % v/v 100 102 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30 % v/v 100 100 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*