Esterase from Acinetobacter venetianus V28
Enzyme Description
Species
Extremophile
No
but "cold-adapted" enzyme
EC Number
Sequence
MMMNTLLPILFRKTFTAFLLSCSLGAMAIQTTQAAEIEMSFQNLLQQERAWAGLQTKTLKVGDITWSYSDGGQAGKPIVILIHGLAGSRDNWNRVAHALTANYHVIIPDLPASGETKVPKEFDYSVPNVTEKLRRFIEAANLTGPAHIAGHSLGGSIAMLYAGQYPFETKSLFLIDAAGVYKSATTPYLKDPAQVKNMIVSKKGDFNYLMQQAMYSPPFIPKEIAQAQEKMMIGQVEETQKMVDQIIALNKLFTPDSFALLAKSIDAPTLILWGKQDKIINVEVAPELKSLLKNAQTPVILDNVGHMPILEADQLVVQQYLPFLSKIQAQKPATAPSP
Young-Ok Kim et al. (2012)
β Gene Cloning and Characterization of a Cold-Adapted Esterase from Acinetobacter venetianus V28
Journal of Microbiology and Biotechnology
Β· doi:10.4014/jmb.1201.01045 β
Β· Activity + Stability - Incubation
▼
Database ID
UniProt: J7EYB1 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (14 measurements)
14 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 15 % v/v | 100 | 101 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 37Β°C | 10 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 15 % v/v | 100 | 102 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 37Β°C | 10 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 15 % v/v | 100 | 103 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 37Β°C | 10 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 15 % v/v | 100 | 102 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 37Β°C | 10 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 15 % v/v | 100 | 102 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 37Β°C | 10 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | PEG-8000 | 15 % v/v | 100 | 101 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 37Β°C | 10 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 15 % v/v | 100 | 101 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 37Β°C | 10 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 30 % v/v | 100 | 101 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 37Β°C | 10 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 30 % v/v | 100 | 102 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 37Β°C | 10 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 30 % v/v | 100 | 100 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 37Β°C | 10 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 30 % v/v | 100 | 101 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 37Β°C | 10 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 30 % v/v | 100 | 99 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 37Β°C | 10 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | PEG-8000 | 30 % v/v | 100 | 102 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 37Β°C | 10 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100 | 100 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 37Β°C | 10 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), reaction in the presence of organic solvent | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control |
Visualization : Activity + Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.