Lipase LipS from Pseudomonas mandelii JR-1

Enzyme Description

Species
Pseudomonas mandelii JR-1 β†—
Extremophile
No but "cold-adapted organism"
EC Number
3.1.1.3 β†—

Sequence

Length: 296 amino acids
MSQGSATRYPLVLVPGMLGFIRLVLYPYWYGIISALRRGGATVFAVQVSPLNSSEVRGEQLLARIEEILRETGAEKVNLIGHSQGSLTARYAAAKRPDRVASVTSVAGPNHGSELADYLEKHYPADTFKGRVLSVLLRWIGALMSLLETGYRGPKLPVDIPASHHSLTTQGVALFNQRYPQGLPETWGGHGPEEVNGVRYYSWSGTLQPGNTDRGGNRFDGTNRSCRLFARTFVRETGHCDGMVGRYSSHLGTVIGDEYPMDHFDIVNQSLGLVGKGADPVRLFVEHAARLKGAGV
Junsung KIM et al. (2013) β€” An Organic Solvent-Tolerant Alkaline Lipase from Cold-Adapted Pseudomonas mandelii ;: Cloning, Expression, and Characterization
Bioscience, Biotechnology, and Biochemistry  Β· doi:10.1271/bbb.120733 β†—  Β· Activity + Stability - Incubation
14 measurements ▼
Database ID
UniProt: H2ETP9 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (14 measurements)

14 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurment, 340 nm) in the presence of organic solvent Ethanol 30 % v/v 222 413 U Digital Continuous Incubation: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100, Assay: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100 Incubation: 8.5, Assay: 8.5 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Water-incubated control (in U), assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurment, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30 % v/v 222 437 U Digital Continuous Incubation: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100, Assay: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100 Incubation: 8.5, Assay: 8.5 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Water-incubated control (in U), assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurment, 340 nm) in the presence of organic solvent Acetone 30 % v/v 222 229 U Digital Continuous Incubation: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100, Assay: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100 Incubation: 8.5, Assay: 8.5 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Water-incubated control (in U), assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurment, 340 nm) in the presence of organic solvent Acetonitrile 30 % v/v 222 153 U Digital Continuous Incubation: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100, Assay: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100 Incubation: 8.5, Assay: 8.5 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Water-incubated control (in U), assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurment, 340 nm) in the presence of organic solvent Isopropanol 30 % v/v 222 149 U Digital Continuous Incubation: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100, Assay: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100 Incubation: 8.5, Assay: 8.5 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Water-incubated control (in U), assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurment, 340 nm) in the presence of organic solvent Methanol 30 % v/v 222 39 U Digital Continuous Incubation: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100, Assay: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100 Incubation: 8.5, Assay: 8.5 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Water-incubated control (in U), assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurment, 340 nm) in the presence of organic solvent Acetic Acid 30 % v/v 222 39 U Digital Continuous Incubation: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100, Assay: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100 Incubation: 8.5, Assay: 8.5 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Water-incubated control (in U), assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (NADH absorbance measurment, 340 nm) in the presence of organic solvent Ethanol 30 % v/v 112 273 U Digital Continuous Incubation: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100, Assay: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100 Incubation: 8.5, Assay: 8.5 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Water-incubated control (in U), assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (NADH absorbance measurment, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30 % v/v 112 374 U Digital Continuous Incubation: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100, Assay: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100 Incubation: 8.5, Assay: 8.5 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Water-incubated control (in U), assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (NADH absorbance measurment, 340 nm) in the presence of organic solvent Acetone 30 % v/v 112 186 U Digital Continuous Incubation: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100, Assay: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100 Incubation: 8.5, Assay: 8.5 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Water-incubated control (in U), assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (NADH absorbance measurment, 340 nm) in the presence of organic solvent Acetonitrile 30 % v/v 112 146 U Digital Continuous Incubation: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100, Assay: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100 Incubation: 8.5, Assay: 8.5 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Water-incubated control (in U), assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (NADH absorbance measurment, 340 nm) in the presence of organic solvent Isopropanol 30 % v/v 112 131 U Digital Continuous Incubation: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100, Assay: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100 Incubation: 8.5, Assay: 8.5 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Water-incubated control (in U), assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (NADH absorbance measurment, 340 nm) in the presence of organic solvent Methanol 30 % v/v 112 42 U Digital Continuous Incubation: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100, Assay: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100 Incubation: 8.5, Assay: 8.5 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Water-incubated control (in U), assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (NADH absorbance measurment, 340 nm) in the presence of organic solvent Acetic Acid 30 % v/v 112 38 U Digital Continuous Incubation: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100, Assay: 100 mM Tris-HCl, 100 mM NaCl, 0.3% Triton X-100 Incubation: 8.5, Assay: 8.5 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Water-incubated control (in U), assay in the presence of organic solvent

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*