Fructose-6-phosphate aldolase (gene fsaA) from Escherichia coli
Enzyme Description
Sequence
MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
Martina Sudar et al. (2013)
β Aldol addition of dihydroxyacetone to N-Cbz-3-aminopropanal catalyzed by two aldolases variants in microreactors
Enzyme and Microbial Technology
Β· doi:10.1016/j.enzmictec.2013.03.013 β
Β· Activity - Classical
▼
Database ID
UniProt: P78055 β
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli
Experimental Data (36 measurements)
36 measurements β page 2 of 2
| Mutation | Property | Assay | Solvent | Solvent Volume | Aqueous Reference | WT Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| A129S | Activity - Classical | Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent | Ethyl Acetate | 20 % v/v | 5.7 | β | 1.1 | U/mg | Digital | Continuous | 50 mM TEA-HCl buffer | 7.5 | 25Β°C | 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal | 6-(N-Cbz-amino)-4-hydroxyhexan-2-one | β | 1000 rpm | Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) ethyl acetate content solution |
| A129S | Activity - Classical | Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent | Ethyl Acetate | 30 % v/v | 5.7 | β | 0.7 | U/mg | Digital | Continuous | 50 mM TEA-HCl buffer | 7.5 | 25Β°C | 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal | 6-(N-Cbz-amino)-4-hydroxyhexan-2-one | β | 1000 rpm | Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) ethyl acetate content solution |
| A129S | Activity - Classical | Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent | Ethyl Acetate | 40 % v/v | 5.7 | β | 0.3 | U/mg | Digital | Continuous | 50 mM TEA-HCl buffer | 7.5 | 25Β°C | 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal | 6-(N-Cbz-amino)-4-hydroxyhexan-2-one | β | 1000 rpm | Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) ethyl acetate content solution |
| A129S | Activity - Classical | Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent | Ethyl Acetate | 50 % v/v | 5.7 | β | 0.0 | U/mg | Digital | Continuous | 50 mM TEA-HCl buffer | 7.5 | 25Β°C | 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal | 6-(N-Cbz-amino)-4-hydroxyhexan-2-one | β | 1000 rpm | Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) ethyl acetate content solution |
| A129S | Activity - Classical | Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent | Acetonitrile | 5 % v/v | 4.0 | β | 4.0 | U/mg | Digital | Continuous | 50 mM TEA-HCl buffer | 7.5 | 25Β°C | 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal | 6-(N-Cbz-amino)-4-hydroxyhexan-2-one | β | 1000 rpm | Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) acetonitrile content solution |
| A129S | Activity - Classical | Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent | Acetonitrile | 10 % v/v | 4.0 | β | 3.7 | U/mg | Digital | Continuous | 50 mM TEA-HCl buffer | 7.5 | 25Β°C | 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal | 6-(N-Cbz-amino)-4-hydroxyhexan-2-one | β | 1000 rpm | Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) acetonitrile content solution |
| A129S | Activity - Classical | Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent | Acetonitrile | 20 % v/v | 4.0 | β | 2.4 | U/mg | Digital | Continuous | 50 mM TEA-HCl buffer | 7.5 | 25Β°C | 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal | 6-(N-Cbz-amino)-4-hydroxyhexan-2-one | β | 1000 rpm | Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) acetonitrile content solution |
| A129S | Activity - Classical | Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent | Ethyl Acetate | 5 % v/v | 5.7 | β | 5.7 | U/mg | Digital | Continuous | 50 mM TEA-HCl buffer | 7.5 | 25Β°C | 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal | 6-(N-Cbz-amino)-4-hydroxyhexan-2-one | β | 1000 rpm | Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) ethyl acetate content solution |
| A129S | Activity - Classical | Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent | Acetonitrile | 40 % v/v | 4.0 | β | 0.7 | U/mg | Digital | Continuous | 50 mM TEA-HCl buffer | 7.5 | 25Β°C | 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal | 6-(N-Cbz-amino)-4-hydroxyhexan-2-one | β | 1000 rpm | Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) acetonitrile content solution |
| A129S | Activity - Classical | Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent | Acetonitrile | 50 % v/v | 4.0 | β | 0.3 | U/mg | Digital | Continuous | 50 mM TEA-HCl buffer | 7.5 | 25Β°C | 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal | 6-(N-Cbz-amino)-4-hydroxyhexan-2-one | β | 1000 rpm | Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) acetonitrile content solution |
| A129S | Activity - Classical | Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent | Dimethylformamide (DMF) | 5 % v/v | 3.4 | β | 3.4 | U/mg | Digital | Continuous | 50 mM TEA-HCl buffer | 7.5 | 25Β°C | 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal | 6-(N-Cbz-amino)-4-hydroxyhexan-2-one | β | 1000 rpm | Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) DMF content solution |
| A129S | Activity - Classical | Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent | Dimethylformamide (DMF) | 10 % v/v | 3.4 | β | 3.2 | U/mg | Digital | Continuous | 50 mM TEA-HCl buffer | 7.5 | 25Β°C | 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal | 6-(N-Cbz-amino)-4-hydroxyhexan-2-one | β | 1000 rpm | Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) DMF content solution |
| A129S | Activity - Classical | Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent | Dimethylformamide (DMF) | 20 % v/v | 3.4 | β | 2.0 | U/mg | Digital | Continuous | 50 mM TEA-HCl buffer | 7.5 | 25Β°C | 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal | 6-(N-Cbz-amino)-4-hydroxyhexan-2-one | β | 1000 rpm | Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) DMF content solution |
| A129S | Activity - Classical | Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent | Dimethylformamide (DMF) | 30 % v/v | 3.4 | β | 1.1 | U/mg | Digital | Continuous | 50 mM TEA-HCl buffer | 7.5 | 25Β°C | 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal | 6-(N-Cbz-amino)-4-hydroxyhexan-2-one | β | 1000 rpm | Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) DMF content solution |
| A129S | Activity - Classical | Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent | Dimethylformamide (DMF) | 40 % v/v | 3.4 | β | 0.8 | U/mg | Digital | Continuous | 50 mM TEA-HCl buffer | 7.5 | 25Β°C | 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal | 6-(N-Cbz-amino)-4-hydroxyhexan-2-one | β | 1000 rpm | Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) DMF content solution |
| A129S | Activity - Classical | Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent | Dimethylformamide (DMF) | 50 % v/v | 3.4 | β | 0.4 | U/mg | Digital | Continuous | 50 mM TEA-HCl buffer | 7.5 | 25Β°C | 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal | 6-(N-Cbz-amino)-4-hydroxyhexan-2-one | β | 1000 rpm | Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) DMF content solution |
Mutations in this dataset (2)
A129S
A129S/A165G
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.