Cephalosporin C deacetylase from Bacillus subtilis CICC 20034
Enzyme Description
Sequence
MQLYDLPLDQLQTYKPNKTAPHDFSDFWASSLHELAKEEAKPELKAESYPADGVKVFRLTYRSFGKAEIEGWYAVPDRQGPHPAIVKYHGYNASYDGDIHDIVNWALHGYAAFGMLVRGQHSSTDTSVSPHGHVPGWMTKGILDKDTYYYRGVYLDAVRALEVISGFDEVDETRIAVIGGSQGGGLSIAAAALSDIPRAVAADYPYLSNFERAIDVALDEPYLEINSFFRKNGSPETEKTAMNTLAYFDIMNLADRVKVPVLMSIGLIDRVTPPSTVFAAYNHLETEKQLKVYRYFGHEYIPSFHTEKLAFLKAHLKG
Qianqian Tian et al. (2013)
β A novel cephalosporin deacetylating acetyl xylan esterase from Bacillus subtilis with high activity toward cephalosporin C and 7-aminocephalosporanic acid
Applied Microbiology and Biotechnology
Β· doi:10.1007/s00253-013-5056-x β
Β· Stability - Incubation
▼
Database ID
UniProt: M1JUH6 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (21 measurements)
21 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Isopropanol | 30 % v/v | 100.0 | 154.0 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | n-Hexane | 50 % v/v | 100.0 | 116.94 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Toluene | 50 % v/v | 100.0 | 92.95 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Benzene | 50 % v/v | 100.0 | 98.43 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Isopropanol | 50 % v/v | 100.0 | 114.25 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Acetone | 50 % v/v | 100.0 | 1.64 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Methanol | 50 % v/v | 100.0 | 6.67 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 100.0 | 32.01 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | n-Hexane | 30 % v/v | 100.0 | 118.77 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Toluene | 30 % v/v | 100.0 | 104.5 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Benzene | 30 % v/v | 100.0 | 172.86 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100.0 | 108.3 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Acetone | 30 % v/v | 100.0 | 93.85 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Methanol | 30 % v/v | 100.0 | 79.5 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100.0 | 78.2 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | n-Hexane | 10 % v/v | 100.0 | 114.89 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Toluene | 10 % v/v | 100.0 | 139.1 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Benzene | 10 % v/v | 100.0 | 133.1 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Isopropanol | 10 % v/v | 100.0 | 124.58 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405) in aqueous phase | Acetone | 10 % v/v | 100.0 | 160.87 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM potassium phosphate buffer | Incubation: ?, Assay: 7 | Incubation: 40Β°C, Assay: 40Β°C | 1.6 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Incubation: 200 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about control |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.