Protease P6 from Bacillus subtilis N7
Enzyme Description
Sequence
TKPYDDNGHGTHCAGDIASSGASSSGKYQGPAPEADLIGVKVLNKSGSGTLADIIEGVEWCIQYNKEHTKNPIRIISMSLGGDALRYDKETDDPLVKAVEKAWNEGIVVCVAAGNSGPEAQTISSPGVSEKVITVGAYDDNDTAGNEDDTVASFSSRGPTVYGKEKPDILAPGVDIVSLRSPRSYLDKLQKSNRVGSLYFSLSGTWMATPICAGIAALILQQNPQLSPDEVKTLIKQSPDQWTNEDPNIYGAGAVNAENAVPKE
Yi Luo et al. (2013)
β Identification and characterization of an anti-fungi Fusarium oxysporum f. sp. cucumerium protease from the Bacillus subtilis strain N7
Journal of Microbiology
Β· doi:10.1007/s12275-013-2627-6 β
Β· Stability - Incubation
▼
Database ID
UniProt: M4QCS3 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Purified, bacterium Bacillus subtilis N7
Experimental Data (4 measurements)
4 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (30 minutes at 60Β°C), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 275 nm) in aqueous phase | Acetone | 25 % v/v | 100 | 57 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9 | Incubation: 60Β°C, Assay: 60Β°C | 1% w/v Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about control |
| Stability - Incubation | Activity after incubation (30 minutes at 60Β°C), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 275 nm) in aqueous phase | 1-Butanol | 25 % v/v | 100 | 71 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9 | Incubation: 60Β°C, Assay: 60Β°C | 1% w/v Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about control |
| Stability - Incubation | Activity after incubation (30 minutes at 60Β°C), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 275 nm) in aqueous phase | Ethanol | 25 % v/v | 100 | 76 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9 | Incubation: 60Β°C, Assay: 60Β°C | 1% w/v Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about control |
| Stability - Incubation | Activity after incubation (30 minutes at 60Β°C), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 275 nm) in aqueous phase | n-Hexane | 25 % v/v | 100 | 102 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9 | Incubation: 60Β°C, Assay: 60Β°C | 1% w/v Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about control |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.