Esterase (gene est10) from Psychrobacter pacificensis

Enzyme Description

Extremophile
No but "psychrotrophic" organism
EC Number

Sequence

Length: 223 amino acids
MSNYLDAVVVEHNPSQKKIDRAVIWLHGLGASGHDFEPVVPQLGLADDMAVRFIFPHAPKRPVTVNGGMVMPAWYDIIEMSLERKVDVAQIEESAQQIQDLISREIERGVSPEHIVIAGFSQGGAVAYHVALGYPERLAGLMTLSTYLATNDNIEYSAANKDMPILIEHGTHDPVVPVILGEHAQQLLTSKGYNVEYHTYSMAHQVCMPQIQNIGKWLNTVLA
Guojie Wu et al. (2013) β€” Characterization of a cold-adapted and salt-tolerant esterase from a psychrotrophic bacterium Psychrobacter pacificensis
Extremophiles  Β· doi:10.1007/s00792-013-0562-4 β†—  Β· Stability - Incubation
27 measurements
Database ID
UniProt: L7XC53 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (27 measurements)

27 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Propanediol 10 % v/v 100.0 93.1 % Digital Continuous Incubation: ?, Assay: Phosphate-citrate buffer Incubation: ?, Assay: 7.5 Incubation: Room temperture, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 10 % v/v 100.0 93.3 % Digital Continuous Incubation: ?, Assay: Phosphate-citrate buffer Incubation: ?, Assay: 7.5 Incubation: Room temperture, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethylene Glycol 10 % v/v 100.0 100.2 % Digital Continuous Incubation: ?, Assay: Phosphate-citrate buffer Incubation: ?, Assay: 7.5 Incubation: Room temperture, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10 % v/v 100.0 108.4 % Digital Continuous Incubation: ?, Assay: Phosphate-citrate buffer Incubation: ?, Assay: 7.5 Incubation: Room temperture, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 10 % v/v 100.0 107.3 % Digital Continuous Incubation: ?, Assay: Phosphate-citrate buffer Incubation: ?, Assay: 7.5 Incubation: Room temperture, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 10 % v/v 100.0 93.3 % Digital Continuous Incubation: ?, Assay: Phosphate-citrate buffer Incubation: ?, Assay: 7.5 Incubation: Room temperture, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 10 % v/v 100.0 97.6 % Digital Continuous Incubation: ?, Assay: Phosphate-citrate buffer Incubation: ?, Assay: 7.5 Incubation: Room temperture, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*