Lipase Lip2Pc from Psychrobacter cryohalolentis K5T
Enzyme Description
Extremophile
No
but "psychrotrophic" organism
EC Number
Sequence
MTLKPSLRAVLTPSAFLPSLGAIVTGALLMTMQATSAQAAGQYYNCANADGCQLVSSQYFTSDHTKTKYPVVLAHGMAGFTKMFGLVDYFYGIPETLMSGGSQVYTTKTSSFNNSEIRGEQLLQKIKTISAISGSPKVNLLGHSQGGIDIRYVAGVAPEYVASVTAIGSPEQGSKTADAVMRTLSEDSLATQAVSVFFQLFGGVTDVGSGTSPTELNKQEAWNTAVALSTDGAAKFNAKFPAAMPTSYCGQPTGTEANGIKYYSFSGVGQITNGLDPSDYMLALTGTSFDNDPNDGLVSACSSRLGYVIRDDYRMNHLDSANQLLGLTAWGQPDPKTLYRDQVNRLKKANL
Ksenia Novototskaya-Vlasova et al. (2013)
β Expression and chaperone-assisted refolding of a new cold-active lipase from Psychrobacter cryohalolentis K5T
Protein Expression and Purification
Β· doi:10.1016/j.pep.2013.07.011 β
Β· Stability - Incubation
▼
Database ID
UniParc: UPI0011F391DE β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (10 measurements)
10 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase | Acetonitrile | 10 % v/v | 100 | 102 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 5Β°C, Assay: 25Β°C | 0.1 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase | Ethanol | 10 % v/v | 100 | 105 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 5Β°C, Assay: 25Β°C | 0.1 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase | Methanol | 10 % v/v | 100 | 107 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 5Β°C, Assay: 25Β°C | 0.1 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100 | 107 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 5Β°C, Assay: 25Β°C | 0.1 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase | Dimethylformamide (DMF) | 10 % v/v | 100 | 103 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 5Β°C, Assay: 25Β°C | 0.1 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase | Acetonitrile | 30 % v/v | 100 | 2 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 5Β°C, Assay: 25Β°C | 0.1 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase | Ethanol | 30 % v/v | 100 | 95 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 5Β°C, Assay: 25Β°C | 0.1 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase | Methanol | 30 % v/v | 100 | 108 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 5Β°C, Assay: 25Β°C | 0.1 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100 | 117 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 5Β°C, Assay: 25Β°C | 0.1 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase | Dimethylformamide (DMF) | 30 % v/v | 100 | 101 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 5Β°C, Assay: 25Β°C | 0.1 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.