Lipase Lip2Pc from Psychrobacter cryohalolentis K5T

Enzyme Description

Species
Psychrobacter cryohalolentis K5T β†—
Extremophile
No but "psychrotrophic" organism
EC Number
3.1.1.3 β†—

Sequence

Length: 351 amino acids
MTLKPSLRAVLTPSAFLPSLGAIVTGALLMTMQATSAQAAGQYYNCANADGCQLVSSQYFTSDHTKTKYPVVLAHGMAGFTKMFGLVDYFYGIPETLMSGGSQVYTTKTSSFNNSEIRGEQLLQKIKTISAISGSPKVNLLGHSQGGIDIRYVAGVAPEYVASVTAIGSPEQGSKTADAVMRTLSEDSLATQAVSVFFQLFGGVTDVGSGTSPTELNKQEAWNTAVALSTDGAAKFNAKFPAAMPTSYCGQPTGTEANGIKYYSFSGVGQITNGLDPSDYMLALTGTSFDNDPNDGLVSACSSRLGYVIRDDYRMNHLDSANQLLGLTAWGQPDPKTLYRDQVNRLKKANL
Ksenia Novototskaya-Vlasova et al. (2013) β€” Expression and chaperone-assisted refolding of a new cold-active lipase from Psychrobacter cryohalolentis K5T
Protein Expression and Purification  Β· doi:10.1016/j.pep.2013.07.011 β†—  Β· Stability - Incubation
10 measurements ▼
Database ID
UniParc: UPI0011F391DE β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (10 measurements)

10 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase Acetonitrile 10 % v/v 100 102 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 5Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase Ethanol 10 % v/v 100 105 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 5Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase Methanol 10 % v/v 100 107 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 5Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10 % v/v 100 107 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 5Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase Dimethylformamide (DMF) 10 % v/v 100 103 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 5Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase Acetonitrile 30 % v/v 100 2 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 5Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase Ethanol 30 % v/v 100 95 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 5Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase Methanol 30 % v/v 100 108 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 5Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 30 % v/v 100 117 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 5Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 5Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase Dimethylformamide (DMF) 30 % v/v 100 101 % Direct Continuous Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 5Β°C, Assay: 25Β°C 0.1 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*