Lipase from Pseudomonas sp.

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 311 amino acids
MNKNKTLLALCLGSALALSGQAFAATGSGYTATKYPIVLAHGMLGFDSLLGIDYWYGIPSALRRDGAQVYVTEVSQLNTSELRGEELLAQVEEIVAISGKPKVNLIGHSQGGPDIRYVAGVRPDLIASVTSVGAPHKGSDVADLISKVPEGSAGEAVIAGLVNAMGAFINFVSGSSSSAPQNSLGSLESLNSEGAARFNAKFPQGIPTTACGEGAYKVNGVRYYSWSGTSPLTNPLDVSDAMMVAGSLAFSGPNDGLVGRCSSHLGMVIRDNYRMNHLDEVNQFMGLTSLFETDPVSVYRQHANRLKNAGL
Maryam Monsef Shokri et al. (2013) β€” Hydrophobic Substitution of Surface Residues Affects Lipase Stability in Organic Solvents
Molecular Biotechnology  Β· doi:10.1007/s12033-013-9716-y β†—  Β· Stability - Incubation
161 measurements
Database ID
UniProt: C7E3F2 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (161 measurements)

161 measurements β€” page 9 of 9
Mutation Property Assay Solvent Solvent Volume Aqueous ReferenceWT Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
S251L Stability - Incubation Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) Dimethylformamide (DMF) 25 % v/v 68 29 20 % Digital Continuous Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic Incubation: 7, Assay: 8 Incubation: 60Β°C, Assay: ? 0.6 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 150 rpm Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
1 … 6 7 8 9
Next β€Ί

Mutations in this dataset (9)

WT N219A N219D N219I N219L N219P N219R S251K S251L

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*