Lipase from Pseudomonas sp.
Enzyme Description
Sequence
Length: 311 amino acids
MNKNKTLLALCLGSALALSGQAFAATGSGYTATKYPIVLAHGMLGFDSLLGIDYWYGIPSALRRDGAQVYVTEVSQLNTSELRGEELLAQVEEIVAISGKPKVNLIGHSQGGPDIRYVAGVRPDLIASVTSVGAPHKGSDVADLISKVPEGSAGEAVIAGLVNAMGAFINFVSGSSSSAPQNSLGSLESLNSEGAARFNAKFPQGIPTTACGEGAYKVNGVRYYSWSGTSPLTNPLDVSDAMMVAGSLAFSGPNDGLVGRCSSHLGMVIRDNYRMNHLDEVNQFMGLTSLFETDPVSVYRQHANRLKNAGL
Maryam Monsef Shokri et al. (2013)
β Hydrophobic Substitution of Surface Residues Affects Lipase Stability in Organic Solvents
Molecular Biotechnology
Β· doi:10.1007/s12033-013-9716-y β
Β· Stability - Incubation
161 measurements
▼
Database ID
UniProt: C7E3F2 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (161 measurements)
161 measurements β page 9 of 9
| Mutation | Property | Assay | Solvent | Solvent Volume | Aqueous Reference | WT Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| S251L | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 68 | 29 | 20 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 84 | β | 59 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 79 | β | 49 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (15 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 78 | β | 37 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (30 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 74 | β | 29 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (60 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 59 | β | 25 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (70 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 54 | β | 20 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (80 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 51 | β | 15 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (90 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 47 | β | 10 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (2.5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 95 | β | 71 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 84 | β | 30 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (7.5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 82 | β | 22 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 79 | β | 14 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (1 minute at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 97 | β | 56 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (2 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 95 | β | 13 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 84 | β | 4 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 84 | β | 59 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (8 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 81 | β | 43 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 79 | β | 29 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| WT | Stability - Incubation | Activity after incubation (12 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 79 | β | 23 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 90 | 59 | 91 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (15 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 86 | 37 | 84 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (30 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 83 | 29 | 80 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (40 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 82 | β | 74 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (50 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 80 | β | 70 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (60 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 75 | 25 | 65 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (70 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 72 | 20 | 61 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (80 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 67 | 15 | 58 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (90 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 61 | 10 | 49 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 90 | 59 | 85 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (30 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 80 | 29 | 73 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (40 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 79 | β | 69 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (50 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 75 | β | 63 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (60 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 69 | 25 | 60 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (70 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 65 | 20 | 57 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (80 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 59 | 15 | 54 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (90 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 55 | 10 | 52 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 88 | 59 | 79 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (30 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 76 | 29 | 70 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (40 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 72 | β | 63 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (50 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 68 | β | 60 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (60 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 65 | 25 | 54 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation 70 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 62 | 20 | 47 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (80 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 58 | 15 | 43 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (90 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 54 | 10 | 40 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219P | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 84 | 59 | 64 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219P | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 80 | 49 | 60 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219P | Stability - Incubation | Activity after incubation (30 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 71 | 29 | 44 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219P | Stability - Incubation | Activity after incubation (40 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 68 | β | 40 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219P | Stability - Incubation | Activity after incubation (55 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 62 | β | 35 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219P | Stability - Incubation | Activity after incubation (60 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 60 | 25 | 30 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219P | Stability - Incubation | Activity after incubation (80 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 56 | 15 | 20 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (2.5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 93 | β | 59 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 84 | 59 | 48 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (7.5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 75 | β | 38 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 66 | 49 | 32 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (20 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 53 | β | 24 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (30 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 45 | 29 | 14 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (40 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 40 | β | 5 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219D | Stability - Incubation | Activity after incubation (2.5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 92 | β | 69 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219D | Stability - Incubation | Activity after incubation (7.5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 72 | β | 48 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219D | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 65 | 49 | 40 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219D | Stability - Incubation | Activity after incubation (20 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 55 | β | 30 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219D | Stability - Incubation | Activity after incubation (30 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 48 | 29 | 16 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219D | Stability - Incubation | Activity after incubation (40 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 46 | β | 6 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (15 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 67 | 37 | 64 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (30 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 60 | 29 | 60 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (40 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 58 | β | 53 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (50 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 56 | β | 38 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (60 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 53 | 25 | 38 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (70 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 50 | 20 | 32 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251L | Stability - Incubation | Activity after incubation (2.5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 86 | β | 72 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251L | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 75 | 59 | 60 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251L | Stability - Incubation | Activity after incubation (7.5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 69 | β | 49 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251L | Stability - Incubation | Activity after incubation (20 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 60 | β | 32 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251L | Stability - Incubation | Activity after incubation (30 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Methanol | 25 % v/v | 55 | 29 | 18 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (2 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 95 | β | 92 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (15 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 86 | β | 50 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (30 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 83 | β | 36 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (40 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 82 | β | 28 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 88 | 14 | 50 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (15 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 87 | β | 32 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (20 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 86 | β | 14 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 88 | 30 | 55 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 85 | 14 | 40 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (15 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 82 | β | 25 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (20 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 80 | β | 10 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219P | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 84 | 30 | 65 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219P | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 80 | 14 | 47 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219P | Stability - Incubation | Activity after incubation (15 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 77 | β | 23 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219P | Stability - Incubation | Activity after incubation (20 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 75 | β | 15 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (2.5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 93 | 71 | 70 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 84 | 30 | 18 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (7.5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 66 | 22 | 10 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219D | Stability - Incubation | Activity after incubation (2.5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 92 | 71 | 83 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219D | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 84 | 30 | 26 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219D | Stability - Incubation | Activity after incubation (7.5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 72 | 22 | 11 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (2 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 94 | β | 92 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 84 | 30 | 79 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (8 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 75 | β | 61 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 71 | 14 | 45 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (12 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 68 | β | 30 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251L | Stability - Incubation | Activity after incubation (2 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 90 | β | 79 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251L | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 75 | 30 | 21 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251L | Stability - Incubation | Activity after incubation (7.5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Ethanol | 25 % v/v | 68 | 22 | 13 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (2 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 95 | 13 | 75 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (8 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 88 | β | 52 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 87 | β | 36 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (12 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 87 | β | 26 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (1 minute at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 98 | 56 | 83 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (2 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 96 | 13 | 60 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (4 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 92 | β | 30 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 88 | β | 15 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (1 minute at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 98 | 56 | 78 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (2 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 95 | 13 | 55 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (4 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 89 | β | 30 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 85 | β | 10 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219P | Stability - Incubation | Activity after incubation (1 minute at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 98 | 56 | 58 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219P | Stability - Incubation | Activity after incubation (2 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 93 | 13 | 36 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219P | Stability - Incubation | Activity after incubation (4 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 86 | β | 8 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (1 minute at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 97 | 56 | 55 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (2 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 93 | 13 | 10 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (3 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 90 | β | 3 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219D | Stability - Incubation | Activity after incubation (1 minute at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 97 | 56 | 50 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219D | Stability - Incubation | Activity after incubation (2 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 93 | 13 | 15 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219D | Stability - Incubation | Activity after incubation (3 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 90 | β | 6 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (1 minute at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 97 | 56 | 82 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (2 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 94 | 13 | 50 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 84 | 4 | 22 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (8 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 75 | β | 14 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 71 | β | 6 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251L | Stability - Incubation | Activity after incubation (1 minute at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | 1-Propanol | 25 % v/v | 93 | 56 | 47 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (2 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 95 | β | 90 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 90 | 59 | 82 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (8 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 87 | 43 | 62 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 87 | 29 | 59 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219L | Stability - Incubation | Activity after incubation (12 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 86 | 23 | 57 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (2 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 96 | β | 96 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 90 | 59 | 87 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (8 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 89 | 43 | 64 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219I | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 88 | 29 | 55 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (2 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 95 | β | 86 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 88 | 59 | 77 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (8 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 86 | 43 | 60 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219A | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 85 | 29 | 52 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 84 | 59 | 50 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (8 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 68 | 43 | 35 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 66 | 29 | 24 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219R | Stability - Incubation | Activity after incubation (12 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 62 | 23 | 19 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219D | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 84 | 59 | 54 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219D | Stability - Incubation | Activity after incubation (8 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 70 | 43 | 30 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219D | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 65 | 29 | 21 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| N219D | Stability - Incubation | Activity after incubation (12 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 61 | 23 | 15 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (1 minute at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 97 | β | 78 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 84 | 59 | 67 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 71 | 29 | 38 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251K | Stability - Incubation | Activity after incubation (12 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 69 | 23 | 20 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251L | Stability - Incubation | Activity after incubation (1 minute at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 93 | β | 82 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251L | Stability - Incubation | Activity after incubation (2 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 90 | β | 75 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251L | Stability - Incubation | Activity after incubation (5 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 75 | 59 | 64 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251L | Stability - Incubation | Activity after incubation (8 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 70 | 43 | 32 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| S251L | Stability - Incubation | Activity after incubation (10 minutes at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) | Dimethylformamide (DMF) | 25 % v/v | 68 | 29 | 20 | % | Digital | Continuous | Incubation: 20 mM phosphate buffer, Assay: Phosphate buffer, 10% isopropanol, 0.4% Triton X-100, 1 mg/ml gum arabic | Incubation: 7, Assay: 8 | Incubation: 60Β°C, Assay: ? | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol, Palmitic Acid | β | Incubation: 150 rpm | Water-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
Mutations in this dataset (9)
WT
N219A
N219D
N219I
N219L
N219P
N219R
S251K
S251L
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume. β β β Reference value. Hover for details.
Mutation Effect
Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.
Structure
Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*
Loadingβ¦
Fetching dataβ¦