Glycosylated elastase from Pseudomonas aeruginosa
Enzyme Description
Sequence
AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL
Minghai Han et al. (2014)
β The role of N-glycosylation sites in the activity, stability, and expression of the recombinant elastase expressed by Pichia pastoris
Enzyme and Microbial Technology
Β· doi:10.1016/j.enzmictec.2013.09.014 β
Β· Stability - Incubation
▼
Database ID
UniProt: P14756 β
Sequence Annotation
Inferred - form protein name (first 197 residues from UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host yeast Pichia pastoris KM71
Experimental Data (6 measurements)
6 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (4 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reaction product with free tyrosines, 750 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 100.0 | 95.1 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate bffer, Assay: 50 mM barbital-HCl | Incubation: 7, Assay: 7 | Incubation: 30Β°C, Assay: 37Β°C | 1% (w/v) Casein | free amino acids , Peptides | β | Incubation: 140 rpm | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (4 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reaction product with free tyrosines, 750 nm) in aqueous phase | Methanol | 50 % v/v | 100.0 | 102.0 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate bffer, Assay: 50 mM barbital-HCl | Incubation: 7, Assay: 7 | Incubation: 30Β°C, Assay: 37Β°C | 1% (w/v) Casein | free amino acids , Peptides | β | Incubation: 140 rpm | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (4 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reaction product with free tyrosines, 750 nm) in aqueous phase | Ethanol | 50 % v/v | 100.0 | 71.5 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate bffer, Assay: 50 mM barbital-HCl | Incubation: 7, Assay: 7 | Incubation: 30Β°C, Assay: 37Β°C | 1% (w/v) Casein | free amino acids , Peptides | β | Incubation: 140 rpm | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (4 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reaction product with free tyrosines, 750 nm) in aqueous phase | Isopropanol | 50 % v/v | 100.0 | 39.2 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate bffer, Assay: 50 mM barbital-HCl | Incubation: 7, Assay: 7 | Incubation: 30Β°C, Assay: 37Β°C | 1% (w/v) Casein | free amino acids , Peptides | β | Incubation: 140 rpm | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (4 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reaction product with free tyrosines, 750 nm) in aqueous phase | 1-Butanol | 50 % v/v | 100.0 | 89.5 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate bffer, Assay: 50 mM barbital-HCl | Incubation: 7, Assay: 7 | Incubation: 30Β°C, Assay: 37Β°C | 1% (w/v) Casein | free amino acids , Peptides | β | Incubation: 140 rpm | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (4 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reaction product with free tyrosines, 750 nm) in aqueous phase | Chloroform | 50 % v/v | 100.0 | 95.6 | % | Direct | Continuous | Incubation: 50 mM sodium phosphate bffer, Assay: 50 mM barbital-HCl | Incubation: 7, Assay: 7 | Incubation: 30Β°C, Assay: 37Β°C | 1% (w/v) Casein | free amino acids , Peptides | β | Incubation: 140 rpm | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.