Non-glycoslated elastase from Pseudomonas aeruginosa

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 301 amino acids
AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL
Minghai Han et al. (2014) β€” The role of N-glycosylation sites in the activity, stability, and expression of the recombinant elastase expressed by Pichia pastoris
Enzyme and Microbial Technology  Β· doi:10.1016/j.enzmictec.2013.09.014 β†—  Β· Stability - Incubation
6 measurements
Database ID
UniProt: P14756 β†—
Sequence Annotation
Inferred - form protein name (first 197 residues from UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host yeast Pichia pastoris KM71

Experimental Data (6 measurements)

6 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (4 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reaction product with free tyrosines, 750 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50 % v/v 100.0 83.2 % Direct Continuous Incubation: 50 mM sodium phosphate bffer, Assay: 50 mM barbital-HCl Incubation: 7, Assay: 7 Incubation: 30Β°C, Assay: 37Β°C 1% (w/v) Casein free amino acids , Peptides β€” Incubation: 140 rpm Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (4 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reaction product with free tyrosines, 750 nm) in aqueous phase Methanol 50 % v/v 100.0 96.5 % Direct Continuous Incubation: 50 mM sodium phosphate bffer, Assay: 50 mM barbital-HCl Incubation: 7, Assay: 7 Incubation: 30Β°C, Assay: 37Β°C 1% (w/v) Casein free amino acids , Peptides β€” Incubation: 140 rpm Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (4 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reaction product with free tyrosines, 750 nm) in aqueous phase Ethanol 50 % v/v 100.0 62.1 % Direct Continuous Incubation: 50 mM sodium phosphate bffer, Assay: 50 mM barbital-HCl Incubation: 7, Assay: 7 Incubation: 30Β°C, Assay: 37Β°C 1% (w/v) Casein free amino acids , Peptides β€” Incubation: 140 rpm Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (4 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reaction product with free tyrosines, 750 nm) in aqueous phase Isopropanol 50 % v/v 100.0 17.5 % Direct Continuous Incubation: 50 mM sodium phosphate bffer, Assay: 50 mM barbital-HCl Incubation: 7, Assay: 7 Incubation: 30Β°C, Assay: 37Β°C 1% (w/v) Casein free amino acids , Peptides β€” Incubation: 140 rpm Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (4 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reaction product with free tyrosines, 750 nm) in aqueous phase 1-Butanol 50 % v/v 100.0 78.5 % Direct Continuous Incubation: 50 mM sodium phosphate bffer, Assay: 50 mM barbital-HCl Incubation: 7, Assay: 7 Incubation: 30Β°C, Assay: 37Β°C 1% (w/v) Casein free amino acids , Peptides β€” Incubation: 140 rpm Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (4 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reaction product with free tyrosines, 750 nm) in aqueous phase Chloroform 50 % v/v 100.0 91.5 % Direct Continuous Incubation: 50 mM sodium phosphate bffer, Assay: 50 mM barbital-HCl Incubation: 7, Assay: 7 Incubation: 30Β°C, Assay: 37Β°C 1% (w/v) Casein free amino acids , Peptides β€” Incubation: 140 rpm Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*