Alkaline hydrolase PA27 from Pseudomonas aeruginosa MH38
Enzyme Description
Species
Extremophile
No
but "Organic Solvent-Stabe hydrolase"
EC Number
Sequence
MHDLRQSGRLASGKAPVVEWSSHSERICPLPGAVMSEPLILDAPNADACIIWLHGLGADRTDFKPVAEALQMVLPSTRFILPQAPSQAVTVNGGWVMPSWYDILAFSPARAIDEDQLNASADQVIALIDEQRAKGIAAERIILAGFSQGGAVVLHTAFRRYAQPLGGVLALSTYAPTFDDLTLDERHKRIPVLHLHGSQDDVVDPALGRAAHDALQAQGVEVGWHDYPMGHEVSLEEIHDIGAWLRKRL
Eunjin Jang et al. (2014)
β Identification, Characterization, and Immobilization of an Organic Solvent-Stable Alkaline Hydrolase (PA27) from Pseudomonas aeruginosa MH38
Molecules
Β· doi:10.3390/molecules190914396 β
Β· Stability - Incubation
▼
Database ID
UniParc: UPI0003DC47E9 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (8 measurements)
8 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment, 405 nm) in aqueoous phase | Acetone | 30 % v/v | 100 | 55 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: ? | 10 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment, 405 nm) in aqueoous phase | Acetone | 50 % v/v | 100 | 7 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: ? | 10 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment, 405 nm) in aqueoous phase | Isopropanol | 30 % v/v | 100 | 27 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: ? | 10 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment, 405 nm) in aqueoous phase | Isopropanol | 50 % v/v | 100 | 5 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: ? | 10 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment, 405 nm) in aqueoous phase | Benzene | 30 % v/v | 100 | 110 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: ? | 10 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment, 405 nm) in aqueoous phase | Benzene | 50 % v/v | 100 | 108 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: ? | 10 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment, 405 nm) in aqueoous phase | n-Hexane | 30 % v/v | 100 | 123 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: ? | 10 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment, 405 nm) in aqueoous phase | n-Hexane | 50 % v/v | 100 | 127 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: ? | 10 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.