Protease from Geobacillus stearothermophilus B-1172
Enzyme Description
Extremophile
Yes
"thermophilic" organism
EC Number
Sequence
MRGKKVWISLLFALALIFTMAFGSTSPAQAAGKSNGEKKYIVGFKQTMSTMSAAKKKDVISEKGGKVQKQFKYVDAASATLNEKAVKELKKDPSVAYVEEDHVAQAYAQSVPYGVSQIKAPALHSQGFTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSVGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIAYNMDVINMSLGGPSGSAALKAAVDKAVASGIVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVNSSNQRASFSSVGSELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDAFYYGKGLINVQAAAQ
Irfana Iqbal et al. (2014)
β Purification and characterization of cloned alkaline protease gene of Geobacillus stearothermophilus
Journal of Basic Microbiology
Β· doi:10.1002/jobm.201400190 β
Β· Stability - Incubation
▼
Database ID
UniProt: A9YEC7 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (15 measurements)
15 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase | 1-Butanol | 10 % v/v | 100 | 118 | % | Digital | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: ?, Assay: 60Β°C | 0.01 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase | 1-Butanol | 20 % v/v | 100 | 129 | % | Digital | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: ?, Assay: 60Β°C | 0.01 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase | 1-Butanol | 30 % v/v | 100 | 111 | % | Digital | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: ?, Assay: 60Β°C | 0.01 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase | Acetone | 10 % v/v | 100 | 103 | % | Digital | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: ?, Assay: 60Β°C | 0.01 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase | Acetone | 20 % v/v | 100 | 108 | % | Digital | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: ?, Assay: 60Β°C | 0.01 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase | Acetone | 30 % v/v | 100 | 114 | % | Digital | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: ?, Assay: 60Β°C | 0.01 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase | Isopropanol | 10 % v/v | 100 | 107 | % | Digital | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: ?, Assay: 60Β°C | 0.01 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase | Isopropanol | 20 % v/v | 100 | 103 | % | Digital | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: ?, Assay: 60Β°C | 0.01 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase | Isopropanol | 30 % v/v | 100 | 91 | % | Digital | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: ?, Assay: 60Β°C | 0.01 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase | Ethanol | 10 % v/v | 100 | 109 | % | Digital | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: ?, Assay: 60Β°C | 0.01 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase | Ethanol | 20 % v/v | 100 | 102 | % | Digital | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: ?, Assay: 60Β°C | 0.01 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase | Ethanol | 30 % v/v | 100 | 89 | % | Digital | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: ?, Assay: 60Β°C | 0.01 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase | Acetonitrile | 10 % v/v | 100 | 113 | % | Digital | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: ?, Assay: 60Β°C | 0.01 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase | Acetonitrile | 20 % v/v | 100 | 96 | % | Digital | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: ?, Assay: 60Β°C | 0.01 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of FolinβCiocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase | Acetonitrile | 30 % v/v | 100 | 77 | % | Digital | Continuous | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: ?, Assay: 60Β°C | 0.01 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.