Lipase (gene ELBn12) from Enterobacter sp. Bn12

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 292 amino acids
MSTSLKYPIVLVHGLLGFDKIGGIYPYFYGIKEALEKAGAKVYIATLSALNSNEMRGEQLLEFVRKVQAETGAAKVNLIGHSQGPLACRYVAATHPDLIASVTSVNGVNHGSEVADLVRLALKPGRLPESIANAALSAFGQLLSALAGEPRLPQSGVDALDALTSEGVAAFNKKYPQGLPAEWGGQGKELDNGVYYYSWSGIIDYNPLHQGMNNLDPLHVAMLAFSILFTNERFQNDGLVGRYSSHLGKVIGSDYSMDHVDAINQLAGVVANNTDPVKLYVDHLARLQAKGL
Parisa Farrokh et al. (2014) β€” Cloning and characterization of newly isolated lipase from Enterobacter sp. Bn12
Brazilian Journal of Microbiology  Β· doi:10.1590/s1517-83822014000200042 β†—  Β· Stability - Incubation
6 measurements
Database ID
UniProt: K4K3B3 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3) pLysS

Experimental Data (6 measurements)

6 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by pH-stat activity assay in aqueous phase Acetone 50 % v/v 100.0 119.59 % Direct Continuous Incubation: 20 mM Tris-HCl,, Assay: 2% gum arabic, deionized water, 0.1M NaOH for titration Incubation: 8, Assay: ? Incubation: 30Β°C, Assay: ? 2 mg/ml Triglyceride free fatty acids , glycerol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by pH-stat activity assay in aqueous phase Ethanol 50 % v/v 100.0 112.99 % Direct Continuous Incubation: 20 mM Tris-HCl,, Assay: 2% gum arabic, deionized water, 0.1M NaOH for titration Incubation: 8, Assay: ? Incubation: 30Β°C, Assay: ? 2 mg/ml Triglyceride free fatty acids , glycerol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by pH-stat activity assay in aqueous phase Methanol 50 % v/v 100.0 105.34 % Direct Continuous Incubation: 20 mM Tris-HCl,, Assay: 2% gum arabic, deionized water, 0.1M NaOH for titration Incubation: 8, Assay: ? Incubation: 30Β°C, Assay: ? 2 mg/ml Triglyceride free fatty acids , glycerol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by pH-stat activity assay in aqueous phase Glycerol 50 % v/v 100.0 111.63 % Direct Continuous Incubation: 20 mM Tris-HCl,, Assay: 2% gum arabic, deionized water, 0.1M NaOH for titration Incubation: 8, Assay: ? Incubation: 30Β°C, Assay: ? 2 mg/ml Triglyceride free fatty acids , glycerol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by pH-stat activity assay in aqueous phase Isopropanol 50 % v/v 100.0 115.71 % Direct Continuous Incubation: 20 mM Tris-HCl,, Assay: 2% gum arabic, deionized water, 0.1M NaOH for titration Incubation: 8, Assay: ? Incubation: 30Β°C, Assay: ? 2 mg/ml Triglyceride free fatty acids , glycerol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by pH-stat activity assay in aqueous phase n-Hexane 50 % v/v 100.0 120.22 % Direct Continuous Incubation: 20 mM Tris-HCl,, Assay: 2% gum arabic, deionized water, 0.1M NaOH for titration Incubation: 8, Assay: ? Incubation: 30Β°C, Assay: ? 2 mg/ml Triglyceride free fatty acids , glycerol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control

Visualization : Stability β€” Incubation

Parisa Farrokh et al. (2014)

One bar per measurement. Colour = solvent, shade = solvent volume.

Parisa Farrokh et al. (2017) β€” Role of Q177A and K173A/Q177A substitutions in thermostability and activity of the ELBn12 lipase
Biotechnology and Applied Biochemistry  Β· doi:10.1002/bab.1576 β†—  Β· Stability - Incubation
28 measurements

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*