Esterase (gene Est-AF) from Archaeoglobus fulgidus

Enzyme Description

Extremophile
Yes hyperthermophilic organism
EC Number

Sequence

Length: 247 amino acids
MERITLEIDALKISVLKGKEKDVMYIHGSGCDATLWERQLEDVGGYAIDLPNHGRSCAAEIRDIGDYAYFVAKTVKKLMGKAVIVGHSLGGAVAQKIYLEYPKVVKALVLVGTGARLRVMPEILTMLKEKPAEAAELVSKYAFSNQELAKEFSKVFAERAGVLHLDLSLCDRFDLLEDYRSGKVKVDIPTLLIVGEKDALTPVKYSEFFKKHIPSAEMVVIPEAGHMVMLEKPDEFNRALKNFIEKL
Jinyeong Kim et al. (2015) β€” Improved enantioselectivity of thermostable esterase from Archaeoglobus fulgidus toward (S)-ketoprofen ethyl ester by directed evolution and characterization of mutant esterases
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-015-6422-7 β†—  Β· Activity - Classical Selectivity - Enantioselectivity
112 measurements
Database ID
UniProt: O27948 β†—
Sequence Annotation
Inferred
Protein Source
Recombinant, host bacterium Escherichia coli XL1-blue

Experimental Data (112 measurements)

112 measurements β€” page 6 of 6
Mutation Property Assay Solvent Solvent Volume Aqueous ReferenceWT Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
L200R Selectivity - Enantioselectivity Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent Acetone 10 % v/v 89.2 -33.8 89.5 % Direct Continuous 50 mM Tris-HCl buffer, 0.1% Triton X-100 8 70Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate Ethanol , R-ketoprofen , S-ketoprofen β€” β€” Classical aqueous control (in %)
L200R Selectivity - Enantioselectivity Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent Acetonitrile 10 % v/v 89.2 -40.0 90.1 % Direct Continuous 50 mM Tris-HCl buffer, 0.1% Triton X-100 8 70Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate Ethanol , R-ketoprofen , S-ketoprofen β€” β€” Classical aqueous control (in %)
L200R Selectivity - Enantioselectivity Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent Dimethylformamide (DMF) 10 % v/v 89.2 -32.3 90.2 % Direct Continuous 50 mM Tris-HCl buffer, 0.1% Triton X-100 8 70Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate Ethanol , R-ketoprofen , S-ketoprofen β€” β€” Classical aqueous control (in %)
L200R Selectivity - Enantioselectivity Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent Dimethylformamide (DMF) 20 % v/v 89.2 -45.4 76.6 % Direct Continuous 50 mM Tris-HCl buffer, 0.1% Triton X-100 8 70Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate Ethanol , R-ketoprofen , S-ketoprofen β€” β€” Classical aqueous control (in %)
L200R Selectivity - Enantioselectivity Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10 % v/v 89.2 -32.7 89.1 % Direct Continuous 50 mM Tris-HCl buffer, 0.1% Triton X-100 8 70Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate Ethanol , R-ketoprofen , S-ketoprofen β€” β€” Classical aqueous control (in %)
L200R Selectivity - Enantioselectivity Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20 % v/v 89.2 -39.1 84.6 % Direct Continuous 50 mM Tris-HCl buffer, 0.1% Triton X-100 8 70Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate Ethanol , R-ketoprofen , S-ketoprofen β€” β€” Classical aqueous control (in %)
L200R Selectivity - Enantioselectivity Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent n-Hexane 10 % v/v 89.2 -17.8 88.7 % Direct Continuous 50 mM Tris-HCl buffer, 0.1% Triton X-100 8 70Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate Ethanol , R-ketoprofen , S-ketoprofen β€” β€” Classical aqueous control (in %)
L200R Selectivity - Enantioselectivity Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent n-Hexane 20 % v/v 89.2 -20.9 92.5 % Direct Continuous 50 mM Tris-HCl buffer, 0.1% Triton X-100 8 70Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate Ethanol , R-ketoprofen , S-ketoprofen β€” β€” Classical aqueous control (in %)
L200R Selectivity - Enantioselectivity Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent Isopropanol 10 % v/v 89.2 -49.3 80.1 % Direct Continuous 50 mM Tris-HCl buffer, 0.1% Triton X-100 8 70Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate Ethanol , R-ketoprofen , S-ketoprofen β€” β€” Classical aqueous control (in %)
L200R Selectivity - Enantioselectivity Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent Ethanol 10 % v/v 89.2 -48.8 90.0 % Direct Continuous 50 mM Tris-HCl buffer, 0.1% Triton X-100 8 70Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate Ethanol , R-ketoprofen , S-ketoprofen β€” β€” Classical aqueous control (in %)
L200R Selectivity - Enantioselectivity Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent Methanol 10 % v/v 89.2 -41.3 89.3 % Direct Continuous 50 mM Tris-HCl buffer, 0.1% Triton X-100 8 70Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate Ethanol , R-ketoprofen , S-ketoprofen β€” β€” Classical aqueous control (in %)
L200R Selectivity - Enantioselectivity Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent Methanol 20 % v/v 89.2 54.4 93.8 % Direct Continuous 50 mM Tris-HCl buffer, 0.1% Triton X-100 8 70Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate Ethanol , R-ketoprofen , S-ketoprofen β€” β€” Classical aqueous control (in %)
1 … 3 4 5 6
Next β€Ί

Mutations in this dataset (3)

WT V138G L200R

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*