Lipase (gene lipA) from a marine sponge Ircinia sp. metagenomic library
Enzyme Description
Species
Na (marine sponge Ircinia sp. metagenomic library)
Extremophile
No
but "alkaline-tolerant" enzyme
EC Number
Sequence
MKKITTLYLCCLLFIFSNSANAGYTQTKYPIVLAHGLMGFDDVLGVDYFYRVPASLSRDGAQVFVTAVSSLNSSEQRGEQLLQQVEQIIALTGTTKVNLIGHSQGAQSIRYVASLRPDLVASATSVGGVNFGSPVADVVRQGLTPGSKLEGIAKTAFDAFGGLIALLSDNSQLPQDALGALESLTTEGALAFNQKYPEGLPAEQCQQGPMYASNGVYYFSWSGTRTLTNIFDPSDAALAITAILIPGDDDGLVSRCSSHLGYVLKDNYRMNHLDEVNQLIGFHHLFATDPLTVYRQHANRLKKLGL
Jing Su et al. (2015)
β A new alkaline lipase obtained from the metagenome of marine sponge Ircinia sp.
World Journal of Microbiology and Biotechnology
Β· doi:10.1007/s11274-015-1859-5 β
Β· Activity - Classical
▼
Database ID
UniParc: UPI0002B26C01 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (10 measurements)
10 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 15 % v/v | 100.0 | 134.42 | % | Direct | Continuous | 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X | 8 | 40Β°C | 0.2 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 15 % v/v | 100.0 | 31.41 | % | Direct | Continuous | 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X | 8 | 40Β°C | 0.2 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 15 % v/v | 100.0 | 133.63 | % | Direct | Continuous | 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X | 8 | 40Β°C | 0.2 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 15 % v/v | 100.0 | 142.31 | % | Direct | Continuous | 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X | 8 | 40Β°C | 0.2 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 15 % v/v | 100.0 | 70.35 | % | Direct | Continuous | 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X | 8 | 40Β°C | 0.2 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 30 % v/v | 100.0 | 173.19 | % | Direct | Continuous | 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X | 8 | 40Β°C | 0.2 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 30 % v/v | 100.0 | 36.66 | % | Direct | Continuous | 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X | 8 | 40Β°C | 0.2 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 30 % v/v | 100.0 | 97.63 | % | Direct | Continuous | 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X | 8 | 40Β°C | 0.2 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 30 % v/v | 100.0 | 159.65 | % | Direct | Continuous | 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X | 8 | 40Β°C | 0.2 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100.0 | 66.67 | % | Direct | Continuous | 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X | 8 | 40Β°C | 0.2 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.