Protease (gene STAP) from Streptomyces koyangensis TN650

Enzyme Description

Extremophile
No but "thermo-alkaline" enzyme
EC Number

Sequence

Length: 388 amino acids
TQSNPPSWGLDRIDQTTAFTKACSIKYPLQGLQWDLPAIQADKAHEKSLGSRQVTVAVIDTGVDDTHPDIAPNFDRQASVNCVAGKPDTADGAWRPSAAESPHGTHVAGEIAAAKNGVGMTGVAPGVKVAGIKVSNPDGFFYTEAVVCGFMWAAEHGVDVTNNSYYTDPWYFNCATDPDQKALVEAVSRASRYAERRGAVNVAAAGNENYDLTSDEITDPSSPNDTTPGDRTVDPSKCLDIPTQLPGVVTVAATGAKGLKSSFSNHGLGVIDIAAPGGDSTAYQTPEPPATSGLILGTLPGGKWGYMAGTSMASPHVACVAALIKSTHPHAPAAMVKALLYAEADATACTKPYDIDGDGKYKAVCEGPKNRNGFYGWGMADALDAVTW
Mouna Ben Elhoul et al. (2015) β€” A novel detergent-stable solvent-tolerant serine thiol alkaline protease from Streptomyces koyangensis TN650
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2015.06.006 β†—  Β· Stability - Incubation
26 measurements
Database ID
Sequence Annotation
Explicit - Provided (124 first residues from UniProt sequence absent from the mature protein)
Protein Source
Purified, bacterium Streptomyces koyangensis TN650

Experimental Data (26 measurements)

26 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase 1-Butanol 50 % v/v 100 110 % Direct Continuous Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 0.01 Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase 1-Hexanol 50 % v/v 100 90 % Direct Continuous Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 0.01 Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Chloroform 50 % v/v 100 180 % Direct Continuous Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 0.01 Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase n-Hexane 50 % v/v 100 125 % Direct Continuous Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 0.01 Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase n-Heptane 50 % v/v 100 150 % Direct Continuous Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 0.01 Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase n-Decane 50 % v/v 100 95 % Direct Continuous Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 0.01 Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*