Esterase (gene Est1) from Psychrobacter pacificensis
Enzyme Description
Species
Extremophile
Yes
"psychrophilic" organism
EC Number
Sequence
MQNSYSHSLSNHKQLTQKSVNRCFNGEQHYYSHESTSTKTSMTFSIYLPDEALAGRRCPAILYLSGLTCNADNVTHKGHFQQKCSELGMILIAPDTSPRSSEDSDVPNDERYFVGQGASYYVDATQAPWSDNFNMQSYIVDELYDLLRSEFPIDSIGITGHSMGGHGALLLGFKFPSKFVSVSALSPVCAASESAWGQAAYTEYFGDDKSLWVQADAAQMIEKVGQQYASILVDQGAADNFLAEGQLQTSKLQDACAKAEQPLTLRYQAGHDHSYYFIQTVINDHIEHHWHMAQMS
Gaobing Wu et al. (2015)
β A cold-adapted, solvent and salt tolerant esterase from marine bacterium Psychrobacter pacificensis
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2015.07.045 β
Β· Stability - Incubation
▼
Database ID
UniProt: A0A1G7A325 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (32 measurements)
32 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Propanediol | 5 % v/v | 100 | 117 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Glycerol | 30 % v/v | 100 | 106 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Glycerol | 15 % v/v | 100 | 123 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Glycerol | 10 % v/v | 100 | 118 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Glycerol | 5 % v/v | 100 | 111 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 30 % v/v | 100 | 46 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 15 % v/v | 100 | 119 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 10 % v/v | 100 | 119 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 5 % v/v | 100 | 120 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100 | 204 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 15 % v/v | 100 | 194 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100 | 161 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 5 % v/v | 100 | 137 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Propanediol | 30 % v/v | 100 | 243 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Propanediol | 15 % v/v | 100 | 170 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Propanediol | 10 % v/v | 100 | 144 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 5 % v/v | 100 | 117 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Butanol | 30 % v/v | 100 | 14 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Butanol | 15 % v/v | 100 | 38 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Butanol | 10 % v/v | 100 | 47 | % | Digital | Continuous | ? Incubation, 20 mM Tris-HCl | Incubation: ?, Assay: 7.5 | Incubation: 4Β°C, Assay: 25Β°C | 0.01 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.