Lipase (UniParc : UPI0006BCF614) from a shallow hot vent sediment metagenomic library
Enzyme Description
Species
Na (shallow hot vent sediment metagenomic library)
Extremophile
Yes
extremophilic organsim (from hydrothermal vent), "thermoresistant" enzyme
EC Number
Sequence
MTITTSERTRPMWQEHIAGRKIGLETGPRPFDPHKPCLLMVHGSGGRGETFRPQLSGLAPYLNPAAIDLPGHGNTPGPGRDQVAHYADWLAEFIRRGPLRPALLGHSLGGAIVMQLALDHPDLAPALVLVGTGSRLRVLPAILDGLLSDFDATLDLVLKYAYAPGADPRWVQAGREIMSQPGPRVVHDDFAACDRYDITDRLGEITAPTLLIYGDQDQLTPPKYGRFLAERLPDARLEIVAGAGHMVNLERHAEVNRLIPPFISAFSPPASS
Antonio Placido et al. (2015)
β Diversity of hydrolases from hydrothermal vent sediments of the Levante Bay, Vulcano Island (Aeolian archipelago) identified by activity-based metagenomics and biochemical characterization of new esterases and an arabinopyranosidase
Applied Microbiology and Biotechnology
Β· doi:10.1007/s00253-015-6873-x β
Β· Activity - Classical
▼
Database ID
UniParc: UPI0006BCF614 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (6 measurements)
6 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Dibutyl Phosphate | 5 % v/v | 360 | 2600 | U/mg | Direct | Continuous | 50 mM potassium phosphate buffer, 0.1% Triton X-100 | 7 | 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Acetonitrile | 30 % v/v | 360 | 1746 | U/mg | Direct | Continuous | 50 mM potassium phosphate buffer, 0.1% Triton X-100 | 7 | 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Propylene Glycol | 30 % v/v | 360 | 1039 | U/mg | Direct | Continuous | 50 mM potassium phosphate buffer, 0.1% Triton X-100 | 7 | 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Methanol | 30 % v/v | 360 | 769 | U/mg | Direct | Continuous | 50 mM potassium phosphate buffer, 0.1% Triton X-100 | 7 | 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Isopropanol | 20 % v/v | 360 | 732 | U/mg | Direct | Continuous | 50 mM potassium phosphate buffer, 0.1% Triton X-100 | 7 | 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Ethanol | 10 % v/v | 360 | 500 | U/mg | Direct | Continuous | 50 mM potassium phosphate buffer, 0.1% Triton X-100 | 7 | 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mg) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.