Esterase (gene Est-gela) from Bacillus gelatini KACC 12197

Enzyme Description

Extremophile
No but "thermostable" enzyme
EC Number

Sequence

Length: 389 amino acids
MPDLLTNVAENYVNQDLFAGIEWRIDQDGKPIFQGCAGVKDIETRTFIPKNAIYRIYSMTKPIVSFLAMMLIERGVFRLSSPIQNFDPRFKSMKVIDQHAHIEPATALITIEHLLTHQAGFSYDFSLGCPISAHYRDAQLIEDGGRDLTDMMGVLAELPLVFHPGTQWKYSISTDVLAHIIECATGERVDDLLQRLIFDPLDMQDTGFSLPLDGASRLMEVYGMRSLHGLPALKPAPHVLVPADLGSSHPTDDPDFRRGGHGLYSTLDDYMAFANMLLSGQTPEGETLLSPAMLKLALAPRVYFGAGGMRINDEPFAGYSWNLLGRVMTDVGAAAYATHLGEFGWSGAAATYFWVDPTKNMTGCVMTQFLGSQHPIGSDMQAAAMSMLG
Jinyeong Kim et al. (2015) β€” Cloning and characterization of a novel thermostable esterase from Bacillus gelatini KACC 12197
Protein Expression and Purification  Β· doi:10.1016/j.pep.2015.08.009 β†—  Β· Activity - Classical Selectivity - Enantioselectivity
45 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli XL1-blue

Experimental Data (45 measurements)

45 measurements β€” page 3 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Selectivity - Enantioselectivity E-value (computed as ln(1-C*(1+eep))/ln(1-C*(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Isopropanol 5 % v/v 2.7 1.8 E-value Direct Continuous 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate (R)-Ketoprofen , (S)-Ketoprofen , Ethanol β€” β€” Classical aqueous control (in E-value)
Selectivity - Enantioselectivity E-value (computed as ln(1-C*(1+eep))/ln(1-C*(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Ethanol 10 % v/v 2.7 1.6 E-value Direct Continuous 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate (R)-Ketoprofen , (S)-Ketoprofen , Ethanol β€” β€” Classical aqueous control (in E-value)
Selectivity - Enantioselectivity E-value (computed as ln(1-C*(1+eep))/ln(1-C*(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Ethanol 5 % v/v 2.7 1.8 E-value Direct Continuous 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate (R)-Ketoprofen , (S)-Ketoprofen , Ethanol β€” β€” Classical aqueous control (in E-value)
Selectivity - Enantioselectivity E-value (computed as ln(1-C*(1+eep))/ln(1-C*(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Methanol 10 % v/v 2.7 1.0 E-value Direct Continuous 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate (R)-Ketoprofen , (S)-Ketoprofen , Ethanol β€” β€” Classical aqueous control (in E-value)
Selectivity - Enantioselectivity E-value (computed as ln(1-C*(1+eep))/ln(1-C*(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Methanol 5 % v/v 2.7 1.3 E-value Direct Continuous 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate (R)-Ketoprofen , (S)-Ketoprofen , Ethanol β€” β€” Classical aqueous control (in E-value)
1 2 3
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*