Ene-reductase (gene oyeRo2) from Rhodococcus opacus 1CP

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 366 amino acids
MSVLFEPITFRGVTVPNRVWMAPMCQYSADVTGRDVGVPGDWHRTHLVTRAIGGAGLILTEATAVSPEGRISPADLGIWNDTQTEAFAEINAQLEYFGAVPGIQLGHAGRKGSAHVPWRGGGSLDGDDRLSWQTVAPSAIGFGDHTPPAAATTADIRKVVADFAAAAERASRAGFKVVEIHAAHGYLLHQFLSPVSNHRTDEYGGSFAGRIRLLLEVVDAVRGVWPAELPVFVRVSATDWLSEEPGLDADSWTPDQTVSLVQALADLGVDLVDVSSGGVASARIPIGPGYQVPFARRIQNETTVPAAAVGLITEPEQAERIVESGEAVAVFLGRELLRDPYWPRKAALVLNAQVTPQIPAQYARAY
Anika Riedel et al. (2015) β€” Functional characterization and stability improvement of a 'thermophilic-like ' ene-reductase from Rhodococcus opacus 1CP
Frontiers in Microbiology  Β· doi:10.3389/fmicb.2015.01073 β†—  Β· Activity - Classical Stability - Incubation
22 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (22 measurements)

22 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (15 minutes at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase Ethanol 20 % v/v 100 0 % Digital Continuous Incubation: 25 mM phosphate buffer, Assay: 25 mM phosphate buffer Incubation: 7.1, Assay: 7.1 Incubation: 25Β°C, Assay: 25Β°C 1 mM Maleimide Succinimide Assay: 140 ΞΌM NADPH β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (20 minutes at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase Ethanol 20 % v/v 100 0 % Digital Continuous Incubation: 25 mM phosphate buffer, Assay: 25 mM phosphate buffer Incubation: 7.1, Assay: 7.1 Incubation: 25Β°C, Assay: 25Β°C 1 mM Maleimide Succinimide Assay: 140 ΞΌM NADPH β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
1 2
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*