Inorganic pyrophosphatase from Haloferax volcanii
Enzyme Description
Sequence
MVNLWEDMETGPNAPDEIYAVVECLKGERNKYEYDKDIPGVVLDRVLHSNVHYPSDYGFIPQTYYDDEDPFDVLVLVEDQTFPGCVIEARPVALMKMDDDGEQDDKVIAVPVEDPRYDHIEDLDDIPQQTLDEIDEFFATYKNLEAGKEVETLGWEDKQAAKDAIEHAMDLYEENFA
Lana J. McMillan et al. (2016)
β Archaeal Inorganic Pyrophosphatase Displays Robust Activity under High-Salt Conditions and in Organic Solvents
Applied and Environmental Microbiology
Β· doi:10.1128/AEM.03055-15 β
Β· Activity - Classical Stability - Incubation
▼
Database ID
UniProt: D4GT97 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host archaeon Haloferax volcanii H26-pJAM2920
Experimental Data (16 measurements)
16 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, orthophosphate and ammonium molybdate reaction product absorbance measurement, 630 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 25 % v/v | 100 | 63 | % | Digital | Continuous | 20 mM Tris-HCl, 1.5 M NaCl, 10 mM MgClβ | 8 | Room temperature | 1.5 mM Pyrophosphate | inorganic orthophosphate | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, orthophosphate and ammonium molybdate reaction product absorbance measurement, 630 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 25 % v/v | 100 | 94 | % | Digital | Continuous | 20 mM Tris-HCl, 1.5 M NaCl, 10 mM MgClβ | 8 | Room temperature | 1.5 mM Pyrophosphate | inorganic orthophosphate | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, orthophosphate and ammonium molybdate reaction product absorbance measurement, 630 nm) in the presence of organic solvent | Ethanol | 25 % v/v | 100 | 110 | % | Digital | Continuous | 20 mM Tris-HCl, 1.5 M NaCl, 10 mM MgClβ | 8 | Room temperature | 1.5 mM Pyrophosphate | inorganic orthophosphate | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, orthophosphate and ammonium molybdate reaction product absorbance measurement, 630 nm) in the presence of organic solvent | Methanol | 25 % v/v | 100 | 150 | % | Digital | Continuous | 20 mM Tris-HCl, 1.5 M NaCl, 10 mM MgClβ | 8 | Room temperature | 1.5 mM Pyrophosphate | inorganic orthophosphate | β | β | Classical aqueous control (in %) |
| Stability - Incubation | Activity after incubation (2 hours on ice), measured by absorbance spectrophotometry (colorimetric assay, orthophosphate and ammonium molybdate reaction product absorbance measurement, 630 nm) in aqueous phase | Ethanol | 30 % v/v | 100 | 91 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, 2M NaCl, Assay: 20 mM Tris-HCl, 2M NaCl, 2.5 mM MgClβ | Incubation: 8, Assay: 8 | Incubation: On ice, Assay: Room temperature | 50 Β΅M Pyrophosphate | inorganic orthophosphate | β | β | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (2 hours on ice), measured by absorbance spectrophotometry (colorimetric assay, orthophosphate and ammonium molybdate reaction product absorbance measurement, 630 nm) in aqueous phase | Methanol | 30 % v/v | 100 | 96 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, 2M NaCl, Assay: 20 mM Tris-HCl, 2M NaCl, 2.5 mM MgClβ | Incubation: 8, Assay: 8 | Incubation: On ice, Assay: Room temperature | 50 Β΅M Pyrophosphate | inorganic orthophosphate | β | β | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (2 hours on ice), measured by absorbance spectrophotometry (colorimetric assay, orthophosphate and ammonium molybdate reaction product absorbance measurement, 630 nm) in aqueous phase | Dimethylformamide (DMF) | 30 % v/v | 100 | 93 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, 2M NaCl, Assay: 20 mM Tris-HCl, 2M NaCl, 2.5 mM MgClβ | Incubation: 8, Assay: 8 | Incubation: On ice, Assay: Room temperature | 50 Β΅M Pyrophosphate | inorganic orthophosphate | β | β | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (2 hours on ice), measured by absorbance spectrophotometry (colorimetric assay, orthophosphate and ammonium molybdate reaction product absorbance measurement, 630 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100 | 93 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, 2M NaCl, Assay: 20 mM Tris-HCl, 2M NaCl, 2.5 mM MgClβ | Incubation: 8, Assay: 8 | Incubation: On ice, Assay: Room temperature | 50 Β΅M Pyrophosphate | inorganic orthophosphate | β | β | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (2 hours on ice), measured by absorbance spectrophotometry (colorimetric assay, orthophosphate and ammonium molybdate reaction product absorbance measurement, 630 nm) in aqueous phase | Ethanol | 40 % v/v | 100 | 99 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, 2M NaCl, Assay: 20 mM Tris-HCl, 2M NaCl, 2.5 mM MgClβ | Incubation: 8, Assay: 8 | Incubation: On ice, Assay: Room temperature | 50 Β΅M Pyrophosphate | inorganic orthophosphate | β | β | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (2 hours on ice), measured by absorbance spectrophotometry (colorimetric assay, orthophosphate and ammonium molybdate reaction product absorbance measurement, 630 nm) in aqueous phase | Methanol | 40 % v/v | 100 | 94 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, 2M NaCl, Assay: 20 mM Tris-HCl, 2M NaCl, 2.5 mM MgClβ | Incubation: 8, Assay: 8 | Incubation: On ice, Assay: Room temperature | 50 Β΅M Pyrophosphate | inorganic orthophosphate | β | β | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (2 hours on ice), measured by absorbance spectrophotometry (colorimetric assay, orthophosphate and ammonium molybdate reaction product absorbance measurement, 630 nm) in aqueous phase | Dimethylformamide (DMF) | 40 % v/v | 100 | 96 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, 2M NaCl, Assay: 20 mM Tris-HCl, 2M NaCl, 2.5 mM MgClβ | Incubation: 8, Assay: 8 | Incubation: On ice, Assay: Room temperature | 50 Β΅M Pyrophosphate | inorganic orthophosphate | β | β | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (2 hours on ice), measured by absorbance spectrophotometry (colorimetric assay, orthophosphate and ammonium molybdate reaction product absorbance measurement, 630 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 40 % v/v | 100 | 96 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, 2M NaCl, Assay: 20 mM Tris-HCl, 2M NaCl, 2.5 mM MgClβ | Incubation: 8, Assay: 8 | Incubation: On ice, Assay: Room temperature | 50 Β΅M Pyrophosphate | inorganic orthophosphate | β | β | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (2 hours on ice), measured by absorbance spectrophotometry (colorimetric assay, orthophosphate and ammonium molybdate reaction product absorbance measurement, 630 nm) in aqueous phase | Ethanol | 50 % v/v | 100 | 93 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, 2M NaCl, Assay: 20 mM Tris-HCl, 2M NaCl, 2.5 mM MgClβ | Incubation: 8, Assay: 8 | Incubation: On ice, Assay: Room temperature | 50 Β΅M Pyrophosphate | inorganic orthophosphate | β | β | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (2 hours on ice), measured by absorbance spectrophotometry (colorimetric assay, orthophosphate and ammonium molybdate reaction product absorbance measurement, 630 nm) in aqueous phase | Methanol | 50 % v/v | 100 | 96 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, 2M NaCl, Assay: 20 mM Tris-HCl, 2M NaCl, 2.5 mM MgClβ | Incubation: 8, Assay: 8 | Incubation: On ice, Assay: Room temperature | 50 Β΅M Pyrophosphate | inorganic orthophosphate | β | β | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (2 hours on ice), measured by absorbance spectrophotometry (colorimetric assay, orthophosphate and ammonium molybdate reaction product absorbance measurement, 630 nm) in aqueous phase | Dimethylformamide (DMF) | 50 % v/v | 100 | 99 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, 2M NaCl, Assay: 20 mM Tris-HCl, 2M NaCl, 2.5 mM MgClβ | Incubation: 8, Assay: 8 | Incubation: On ice, Assay: Room temperature | 50 Β΅M Pyrophosphate | inorganic orthophosphate | β | β | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (2 hours on ice), measured by absorbance spectrophotometry (colorimetric assay, orthophosphate and ammonium molybdate reaction product absorbance measurement, 630 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 100 | 99 | % | Digital | Continuous | Incubation: 20 mM Tris-HCl, 2M NaCl, Assay: 20 mM Tris-HCl, 2M NaCl, 2.5 mM MgClβ | Incubation: 8, Assay: 8 | Incubation: On ice, Assay: Room temperature | 50 Β΅M Pyrophosphate | inorganic orthophosphate | β | β | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.