Ο-transaminase from Geobacillus thermodenitrificans DSM 465
Enzyme Description
Extremophile
Yes
"thermophilic" organism
EC Number
Sequence
MKTEQSHQLWLDKDDRYIWHSMKPYNPNATVVVTEAKGCWVTDVAGNKYLDAMAGLWCVNVGYGREELAEAAYEQLKTLPYFPLTQSHLPAIQLGEKLNELLGDEYVIFFSNSGSEANETAFKIARQYHQQRGEPHRYKIISRYRAYHGNSMGALAATGQAQRKYKYEPLAPGFIHVPPPDRYRDPDAADDPRQLRAVKAVDDVMTWELSETIAAMIMEPIITGGGVLMPPDGYMKAVKEVCEKHGALLIVDEVICGFGRTGKPFGFMHEGIKPDIITMAKGITSAYLPLAATAVRKEIYEAFKGTDEYDYFRHVNTFGGHPASCALALKNIEIMETEHLFDRSREAGEWLLSALKTKLADHPYVGDVRGRGLLVGIELVADQTTKEPLDVSLVNQVISRCKEHGVIIGKNGATVAGYNNVLTLSPPLCISDDELSFLVRVLTEALAQIK
Yujie Chen et al. (2015)
β Identification of novel thermostable taurineβpyruvate transaminase from Geobacillus thermodenitrificans for chiral amine synthesis
Applied Microbiology and Biotechnology
Β· doi:10.1007/s00253-015-7129-5 β
Β· Activity - Classical
▼
Database ID
UniProt: A0A0S2VC96 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (7 measurements)
7 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity (acetophenone product formation after 10 minutes incubation at 37Β°C) measured by HPLC in the presence of organic solvent | Methanol | 5 % v/v | 100 | 83 | % | Digital | Continuous | 100 mM Tris-HCl buffer | 9 | 37Β°C | 10 mM (S)-Ξ±-methylbenzylamine, 10 mM Pyruvate | Acetophenone , L-Alanine | 20 ΞΌM PLP | β | Classical aqueous control (in %) |
| Activity - Classical | Activity (acetophenone product formation after 10 minutes incubation at 37Β°C) measured by HPLC in the presence of organic solvent | Methanol | 10 % v/v | 100 | 46 | % | Digital | Continuous | 100 mM Tris-HCl buffer | 9 | 37Β°C | 10 mM (S)-Ξ±-methylbenzylamine, 10 mM Pyruvate | Acetophenone , L-Alanine | 20 ΞΌM PLP | β | Classical aqueous control (in %) |
| Activity - Classical | Activity (acetophenone product formation after 10 minutes incubation at 37Β°C) measured by HPLC in the presence of organic solvent | Methanol | 20 % v/v | 100 | 15 | % | Digital | Continuous | 100 mM Tris-HCl buffer | 9 | 37Β°C | 10 mM (S)-Ξ±-methylbenzylamine, 10 mM Pyruvate | Acetophenone , L-Alanine | 20 ΞΌM PLP | β | Classical aqueous control (in %) |
| Activity - Classical | Activity (acetophenone product formation after 10 minutes incubation at 37Β°C) measured by HPLC in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 5 % v/v | 100 | 107 | % | Digital | Continuous | 100 mM Tris-HCl buffer | 9 | 37Β°C | 10 mM (S)-Ξ±-methylbenzylamine, 10 mM Pyruvate | Acetophenone , L-Alanine | 20 ΞΌM PLP | β | Classical aqueous control (in %) |
| Activity - Classical | Activity (acetophenone product formation after 10 minutes incubation at 37Β°C) measured by HPLC in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100 | 134 | % | Digital | Continuous | 100 mM Tris-HCl buffer | 9 | 37Β°C | 10 mM (S)-Ξ±-methylbenzylamine, 10 mM Pyruvate | Acetophenone , L-Alanine | 20 ΞΌM PLP | β | Classical aqueous control (in %) |
| Activity - Classical | Activity (acetophenone product formation after 10 minutes incubation at 37Β°C) measured by HPLC in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 100 | 81 | % | Digital | Continuous | 100 mM Tris-HCl buffer | 9 | 37Β°C | 10 mM (S)-Ξ±-methylbenzylamine, 10 mM Pyruvate | Acetophenone , L-Alanine | 20 ΞΌM PLP | β | Classical aqueous control (in %) |
| Activity - Classical | Activity (acetophenone product formation after 10 minutes incubation at 37Β°C) measured by HPLC in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 40 % v/v | 100 | 23 | % | Digital | Continuous | 100 mM Tris-HCl buffer | 9 | 37Β°C | 10 mM (S)-Ξ±-methylbenzylamine, 10 mM Pyruvate | Acetophenone , L-Alanine | 20 ΞΌM PLP | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.