Carboxylesterase (gene CaesCCR11) from Geobacillus thermoleovoras CR11
Enzyme Description
Extremophile
Yes
"thermophilic" organism
EC Number
Sequence
MSEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSTGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLTRLMAQTKAKLDRIVCPALIFVSDEDHVVPPGNADIIFQGISSTEKEIVCLRNSYHVATLDYDQPMIIERSLEFFAKHAG
Graciela Espinosa-Luna et al. (2015)
β Gene Cloning and Characterization of the Geobacillus thermoleovorans CCR11 Carboxylesterase CaesCCR11, a New Member of Family XV
Molecular Biotechnology
Β· doi:10.1007/s12033-015-9901-2 β
Β· Stability - Incubation
▼
Database ID
UniProt: W8QMJ2 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (9 measurements)
9 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | 1,4-Dioxane | 100 % v/v | 100.0 | 13.2 | % | Direct | Continuous | Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol | Incubation: /, Assay: 8 | Incubation: 30Β°C, Assay: 60Β°C | 1 mM p-Nitrophenyl laurate | Lauric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme |
| Stability - Incubation | Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Methanol | 100 % v/v | 100.0 | 12.7 | % | Direct | Continuous | Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol | Incubation: /, Assay: 8 | Incubation: 30Β°C, Assay: 60Β°C | 1 mM p-Nitrophenyl laurate | Lauric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme |
| Stability - Incubation | Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Ethyl Acetate | 100 % v/v | 100.0 | 24.8 | % | Direct | Continuous | Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol | Incubation: /, Assay: 8 | Incubation: 30Β°C, Assay: 60Β°C | 1 mM p-Nitrophenyl laurate | Lauric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme |
| Stability - Incubation | Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Ethanol | 100 % v/v | 100.0 | 27.5 | % | Direct | Continuous | Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol | Incubation: /, Assay: 8 | Incubation: 30Β°C, Assay: 60Β°C | 1 mM p-Nitrophenyl laurate | Lauric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme |
| Stability - Incubation | Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetone | 100 % v/v | 100.0 | 21.8 | % | Direct | Continuous | Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol | Incubation: /, Assay: 8 | Incubation: 30Β°C, Assay: 60Β°C | 1 mM p-Nitrophenyl laurate | Lauric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme |
| Stability - Incubation | Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | 1-Propanol | 100 % v/v | 100.0 | 13.1 | % | Direct | Continuous | Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol | Incubation: /, Assay: 8 | Incubation: 30Β°C, Assay: 60Β°C | 1 mM p-Nitrophenyl laurate | Lauric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme |
| Stability - Incubation | Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | 1-Butanol | 100 % v/v | 100.0 | 22.9 | % | Direct | Continuous | Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol | Incubation: /, Assay: 8 | Incubation: 30Β°C, Assay: 60Β°C | 1 mM p-Nitrophenyl laurate | Lauric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme |
| Stability - Incubation | Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | n-Hexane | 100 % v/v | 100.0 | 59.2 | % | Direct | Continuous | Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol | Incubation: /, Assay: 8 | Incubation: 30Β°C, Assay: 60Β°C | 1 mM p-Nitrophenyl laurate | Lauric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme |
| Stability - Incubation | Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | n-Heptane | 100 % v/v | 100.0 | 74.6 | % | Direct | Continuous | Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol | Incubation: /, Assay: 8 | Incubation: 30Β°C, Assay: 60Β°C | 1 mM p-Nitrophenyl laurate | Lauric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.