Esterase (gene est4) from a marine mud metagenomic library
Enzyme Description
Sequence
MLVLWLLFLFFMSMLGLVLFASFSNKKAEQFLPPAGQFAKLSQGTLHYLDEGQGPAVVLVHGLAGNFHNFTYGVSKPLSAQYRVIAVDRPGCGYSKRNPHADASLEAQADTLIELLDHLKIESAVFVGHSLGGAISLAAAQRHPSRIKALALIAPLTHQPESPAPVFKPLDIPSPVLRKLIGWTFAVPGTLLRMSTSLKFIFGPEKAPADFAIRGGGILALKPQTFITASSDLQQVKACMPNIEAAYASMTTPVHVLYGREDRILSAKLNGEDLAQRLPGTQLTLINGGHMLPVTQAEVTCQFIAGVAGKATGLAP
Wenyuan Gao et al. (2016)
β A novel esterase from a marine mud metagenomic library for biocatalytic synthesis of short-chain flavor esters
Microbial Cell Factories
Β· doi:10.1186/s12934-016-0435-5 β
Β· Stability - Incubation
▼
Database ID
UniParc: UPI0006CE451D β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (39 measurements)
39 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 100 % v/v | 100.0 | 4.9 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Benzene | 50 % v/v | 100.0 | 76.1 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Toluene | 50 % v/v | 100.0 | 88.1 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Cyclohexane | 50 % v/v | 100.0 | 92.7 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 50 % v/v | 100.0 | 95.3 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Heptane | 50 % v/v | 100.0 | 96.9 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isooctane | 50 % v/v | 100.0 | 90.0 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 100 % v/v | 100.0 | 0.6 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethylformamide (DMF) | 100 % v/v | 100.0 | 5.8 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 100 % v/v | 100.0 | 1.3 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 50 % v/v | 100.0 | 0.0 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetone | 100 % v/v | 100.0 | 85.2 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 100 % v/v | 100.0 | 89.0 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 100 % v/v | 100.0 | 97.0 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Benzene | 100 % v/v | 100.0 | 92.8 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Toluene | 100 % v/v | 100.0 | 90.1 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Cyclohexane | 100 % v/v | 100.0 | 99.7 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 100 % v/v | 100.0 | 98.6 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Heptane | 100 % v/v | 100.0 | 97.6 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isooctane | 100 % v/v | 100.0 | 98.4 | % | Direct | Continuous | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.