Lipase from Aneurinibacillus thermoaerophilus HZ
Enzyme Description
Extremophile
Yes
"thermophilic"
EC Number
Sequence
MQKERKNQYPIVLVHGFAGWGRDEMLGVKYWGGMHDIQEDLKQYGYETHTAVVGPFSSNWDRACELYAQLVGGTVDYGAAHAEKYGHDRFGRTYPGLLKNWDGEHKIHLIGHSMGGQTVRVLTQLLKEGSQEEREYAKKHGVQLSPLFEGGKSWVHSVTTIATPNDGTTLADVVTQLIPAAQQIMGLAAAVSGNTNVPVYDFKLDQWGLKRKAGESFVHYADRVWNSGIWTNTKDISAWDLKPEGAKELNNWVKAQPDVYYFSYSGEATFRSLITGHHLPDLTMNKLITPFGIFLGCYGSDEKWWQNDGIVNTISMNGPKLGSTDEIVPYDGTPKIGKWNDMGIQENWDHADYIGLSLSYVLGIEKIEDFYRGVADMLGSLSVR
Malihe Masomian et al. (2016)
β Analysis of Comparative Sequence and Genomic Data to Verify Phylogenetic Relationship and Explore a New Subfamily of Bacterial Lipases
PLOS ONE
Β· doi:10.1371/journal.pone.0149851 β
Β· Stability - Incubation
▼
Database ID
UniProt: D3XB96 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli TOP10
Experimental Data (7 measurements)
7 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (Kwon and Rhee colorimetric assay, absorbance of copper acetateβpyridine and free fatty acids reaction product measurement, 715 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 25 % v/v | 100 | 106 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 50Β°C, Assay: 65Β°C | ? mM Olive oil | free fatty acids , glycerol | β | Incubation: 150 rpm | Water-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (Kwon and Rhee colorimetric assay, absorbance of copper acetateβpyridine and free fatty acids reaction product measurement, 715 nm) in aqueous phase | Isopropyl Acetate | 25 % v/v | 100 | 31 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 50Β°C, Assay: 65Β°C | ? mM Olive oil | free fatty acids , glycerol | β | Incubation: 150 rpm | Water-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (Kwon and Rhee colorimetric assay, absorbance of copper acetateβpyridine and free fatty acids reaction product measurement, 715 nm) in aqueous phase | Chloroform | 25 % v/v | 100 | 98 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 50Β°C, Assay: 65Β°C | ? mM Olive oil | free fatty acids , glycerol | β | Incubation: 150 rpm | Water-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (Kwon and Rhee colorimetric assay, absorbance of copper acetateβpyridine and free fatty acids reaction product measurement, 715 nm) in aqueous phase | 2-Octanol | 25 % v/v | 100 | 60 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 50Β°C, Assay: 65Β°C | ? mM Olive oil | free fatty acids , glycerol | β | Incubation: 150 rpm | Water-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (Kwon and Rhee colorimetric assay, absorbance of copper acetateβpyridine and free fatty acids reaction product measurement, 715 nm) in aqueous phase | 1-Decanol | 25 % v/v | 100 | 86 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 50Β°C, Assay: 65Β°C | ? mM Olive oil | free fatty acids , glycerol | β | Incubation: 150 rpm | Water-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (Kwon and Rhee colorimetric assay, absorbance of copper acetateβpyridine and free fatty acids reaction product measurement, 715 nm) in aqueous phase | n-Decane | 25 % v/v | 100 | 91 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 50Β°C, Assay: 65Β°C | ? mM Olive oil | free fatty acids , glycerol | β | Incubation: 150 rpm | Water-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (Kwon and Rhee colorimetric assay, absorbance of copper acetateβpyridine and free fatty acids reaction product measurement, 715 nm) in aqueous phase | n-Hexadecane | 25 % v/v | 100 | 97 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 50Β°C, Assay: 65Β°C | ? mM Olive oil | free fatty acids , glycerol | β | Incubation: 150 rpm | Water-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.