Esterase (gene Lip10) from Monascus ruber M7
Enzyme Description
Species
Extremophile
No
but "cold-active" and "organic solventβtolerant" enzyme
EC Number
Sequence
MADSKNHEALNPIHPSVLPHLDPTFVQLYNENVANTPNRPIDLSVLRSKYSVLYSYGTGPAPDCARVWETEVPAFEGALIRVRVYEPASKGPWPVHVDFHGGGWGLGDLDTESHICKHLCVKADVAVIDVDYRLVPEYPFPIGIQDSFAALQYIHQHGAEEFNIDPTRISIGGVSAGGNIALVCAHLARDEKLPLRLVVAGTPTIDDISRYASAQDSPFRSMQEMEHAPTLNWARLKWFDNLKWQSLSADPAEKEKQMAAVKWYANALNAPDFSHLPKTVVYTAGCDPLRDEGEAYARRLVEAGNEVLQLRFLGVPHPFMHMDKDLSQARDFIDRMAFEIKVALHGKR
Hailun Guo et al. (2016)
β Cloning, expression and characterization of a novel cold-active and organic solvent-tolerant esterase from Monascus ruber M7
Extremophiles
Β· doi:10.1007/s00792-016-0835-9 β
Β· Stability - Incubation
▼
Database ID
UniProt: A0A0S2CGG8 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (8 measurements)
8 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (24 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Toluene | 50 % v/v | 100 | 216 | % | Digital | Continuous | Incubation: 50 mM TrisβHCl buffer, Assay: 50 mM TrisβHCl buffer, 2% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 20Β°C, Assay: 40Β°C | 0.4 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | n-Hexane | 50 % v/v | 100 | 212 | % | Digital | Continuous | Incubation: 50 mM TrisβHCl buffer, Assay: 50 mM TrisβHCl buffer, 2% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 20Β°C, Assay: 40Β°C | 0.4 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | n-Heptane | 50 % v/v | 100 | 198 | % | Digital | Continuous | Incubation: 50 mM TrisβHCl buffer, Assay: 50 mM TrisβHCl buffer, 2% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 20Β°C, Assay: 40Β°C | 0.4 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Chloroform | 50 % v/v | 100 | 184 | % | Digital | Continuous | Incubation: 50 mM TrisβHCl buffer, Assay: 50 mM TrisβHCl buffer, 2% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 20Β°C, Assay: 40Β°C | 0.4 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Methanol | 50 % v/v | 100 | 54 | % | Digital | Continuous | Incubation: 50 mM TrisβHCl buffer, Assay: 50 mM TrisβHCl buffer, 2% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 20Β°C, Assay: 40Β°C | 0.4 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Ethanol | 50 % v/v | 100 | 71 | % | Digital | Continuous | Incubation: 50 mM TrisβHCl buffer, Assay: 50 mM TrisβHCl buffer, 2% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 20Β°C, Assay: 40Β°C | 0.4 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Acetonitrile | 50 % v/v | 100 | 52 | % | Digital | Continuous | Incubation: 50 mM TrisβHCl buffer, Assay: 50 mM TrisβHCl buffer, 2% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 20Β°C, Assay: 40Β°C | 0.4 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 100 | 61 | % | Digital | Continuous | Incubation: 50 mM TrisβHCl buffer, Assay: 50 mM TrisβHCl buffer, 2% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 20Β°C, Assay: 40Β°C | 0.4 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Incubation: 200 rpm | Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.